Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MLF1 rabbit polyclonal antibody. Western Blot analysis of MLF1 expression in mouse testis.)

Rabbit anti-Human, Mouse MLF1 Polyclonal Antibody | anti-MLF1 antibody

MLF1 (Myeloid Leukemia Factor 1, Myelodysplasia-myeloid Leukemia Factor 1) APC

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MLF1; Polyclonal Antibody; MLF1 (Myeloid Leukemia Factor 1; Myelodysplasia-myeloid Leukemia Factor 1) APC; anti-MLF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MLF1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MLF1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MLF1, aa1-268 (NP_071888.1).
Immunogen Sequence
MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(MLF1 rabbit polyclonal antibody. Western Blot analysis of MLF1 expression in mouse testis.)

Western Blot (WB) (MLF1 rabbit polyclonal antibody. Western Blot analysis of MLF1 expression in mouse testis.)

Western Blot (WB)

(Western Blot analysis of MLF1 expression in transfected 293T cell line by MLF1 polyclonal antibody. Lane 1: MLF1 transfected lysate (30.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MLF1 expression in transfected 293T cell line by MLF1 polyclonal antibody. Lane 1: MLF1 transfected lysate (30.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MLF1 antibody
MLF1 is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. The protein interferes with erythopoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. It suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest. It binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus.
Product Categories/Family for anti-MLF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,627 Da
NCBI Official Full Name
myeloid leukemia factor 1 isoform 1
NCBI Official Synonym Full Names
myeloid leukemia factor 1
NCBI Official Symbol
MLF1
NCBI Protein Information
myeloid leukemia factor 1; myelodysplasia-myeloid leukemia factor 1
UniProt Protein Name
Myeloid leukemia factor 1
Protein Family
UniProt Gene Name
MLF1
UniProt Entry Name
MLF1_HUMAN

NCBI Description

This gene encodes an oncoprotein which is thought to play a role in the phenotypic determination of hemopoetic cells. Translocations between this gene and nucleophosmin have been associated with myelodysplastic syndrome and acute myeloid leukemia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2010]

Uniprot Description

MLF1: Involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. Interferes with erythropoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. Suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest. Binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus. A chromosomal aberration involving MLF1 is a cause of myelodysplastic syndrome (MDS). Translocation t(3;5)(q25.1;q34) with NPM1/NPM. Belongs to the MLF family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 3q25.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein domain specific binding; protein binding; DNA binding

Biological Process: myeloid progenitor cell differentiation; transcription, DNA-dependent; cell cycle arrest

Disease: Leukemia, Acute Myeloid

Research Articles on MLF1

Similar Products

Product Notes

The MLF1 mlf1 (Catalog #AAA6385534) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MLF1 (Myeloid Leukemia Factor 1, Myelodysplasia-myeloid Leukemia Factor 1) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MLF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MLF1 mlf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MLF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.