Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Mitofusin 1 antibody (MBS839893) used at 1 ug/ml to detect target protein.)

Rabbit Mitofusin 1 Polyclonal Antibody | anti-MFN1 antibody

Mitofusin 1 antibody

Gene Names
MFN1; hfzo1; hfzo2
Applications
Western Blot
Purity
Affinity purified
Synonyms
Mitofusin 1; Polyclonal Antibody; Mitofusin 1 antibody; Polyclonal Mitofusin 1; Anti-Mitofusin 1; hfzo1; Mitofusin -1; hfzo2; MGC41806; DKFZp762F247; FLJ20693; MFN1; anti-MFN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Mitofusin 1 antibody was raised against the middle region of MFN1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MFN1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
741
Applicable Applications for anti-MFN1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.
Cross-Reactivity
Human
Immunogen
Mitofusin 1 antibody was raised using the middle region of MFN1 corresponding to a region with amino acids QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Mitofusin 1 antibody (MBS839893) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Mitofusin 1 antibody (MBS839893) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-MFN1 antibody
Rabbit polyclonal Mitofusin 1 antibody raised against the middle region of MFN1
Product Categories/Family for anti-MFN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
84 kDa (MW of target protein)
NCBI Official Full Name
Mitofusin 1
NCBI Official Synonym Full Names
mitofusin 1
NCBI Official Symbol
MFN1
NCBI Official Synonym Symbols
hfzo1; hfzo2
NCBI Protein Information
mitofusin-1
UniProt Protein Name
Mitofusin-1
Protein Family
UniProt Gene Name
MFN1
UniProt Entry Name
MFN1_HUMAN

NCBI Description

The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting. [provided by RefSeq, Jul 2008]

Uniprot Description

MFN1: Essential transmembrane GTPase, which mediates mitochondrial fusion. Fusion of mitochondria occurs in many cell types and constitutes an important step in mitochondria morphology, which is balanced between fusion and fission. MFN1 acts independently of the cytoskeleton. Overexpression induces the formation of mitochondrial networks. Belongs to the mitofusin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Mitochondrial; Membrane protein, integral; EC 3.6.5.-; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3q26.33

Cellular Component: mitochondrial outer membrane; integral to membrane

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: mitochondrial fusion; metabolic process

Research Articles on MFN1

Similar Products

Product Notes

The MFN1 mfn1 (Catalog #AAA839893) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Mitofusin 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the MFN1 mfn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Mitofusin 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.