<
Western Blot (WB)
(Host: RabbitTarget Name: SMCR7LSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Rabbit MIEF1 Polyclonal Antibody | anti-MIEF1 antibody
MIEF1 Antibody - N-terminal region
Gene Names
MIEF1; MID51; SMCR7L; AltMIEF1; HSU79252; MIEF1-MP; dJ1104E15.3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MIEF1; Polyclonal Antibody; MIEF1 Antibody - N-terminal region; anti-MIEF1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLN
Sequence Length
463
Applicable Applications for anti-MIEF1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SMCR7L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SMCR7LSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SMCR7LSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SMCR7LSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SMCR7LSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SMCR7LSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SMCR7LSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-SMCR7L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HT1080 cell lysateSMCR7L is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)
Western Blot (WB)
(WB Suggested Anti-SMCR7L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HT1080 cell lysateSMCR7L is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)
Related Product Information for anti-MIEF1 antibody
This is a rabbit polyclonal antibody against SMCR7L. It was validated on Western Blot using a cell lysate as a positive control.
Product Categories/Family for anti-MIEF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51kDa
NCBI Official Full Name
mitochondrial dynamics protein MID51 isoform 1
NCBI Official Synonym Full Names
mitochondrial elongation factor 1
NCBI Official Symbol
MIEF1
NCBI Official Synonym Symbols
MID51; SMCR7L; AltMIEF1; HSU79252; MIEF1-MP; dJ1104E15.3
NCBI Protein Information
mitochondrial dynamics protein MID51
UniProt Protein Name
Mitochondrial dynamics protein MID51
Protein Family
UniProt Gene Name
MIEF1
UniProt Synonym Gene Names
MID51; SMCR7L; SMCR7-like protein
UniProt Entry Name
MID51_HUMAN
Research Articles on MIEF1
Similar Products
Product Notes
The MIEF1 mief1 (Catalog #AAA3209444) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MIEF1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MIEF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MIEF1 mief1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GAAMLGIATL AVKRMYDRAI SAPTSPTRLS HSGKRSWEEP NWMGSPRLLN. It is sometimes possible for the material contained within the vial of "MIEF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
