Rabbit anti-Human Midkine Polyclonal Antibody | anti-MK antibody

Midkine (MK, Amphiregulin Associated Protein, ARAP, FLJ27379, Midgestation and Kidney Protein, MDK, MK1, Neurite Growth Promoting Factor 2, NEGF2, Neurite Outgrowth Promoting Protein) (HRP)

Cat. Num. AAA6385460

• Gene Names: MDK; MK; ARAP; NEGF2
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Midkine; Polyclonal Antibody; Midkine (MK; Amphiregulin Associated Protein; ARAP; FLJ27379; Midgestation and Kidney Protein; MDK; MK1; Neurite Growth Promoting Factor 2; NEGF2; Neurite Outgrowth Promoting Protein) (HRP); anti-MK antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MDK.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-MK antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human MDK, aa1-143 (NP_001012333.1).
• Immunogen Sequence: MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MDK expression in transfected 293T cell line by MDK polyclonal antibody. Lane 1: MDK transfected lysate (15.6kD) Lane 2: Non-transfected lysate.)

Related Product Information for anti-MK antibody

Midkine (MK) is a 13kD heparin-binding polypeptide which enhances neurite outgrowth, neuronal cell survival and plasminogen activator activity. MK is structurally divided into two domains, and most of the biological activities are located on the C-terminal domain. Both domains consist of three antiparallel beta-strands, but the C-terminal domain has a long flexible hairpin loop where a heparin-binding consensus sequence is located. MK is a member of a highly conserved, developmentally regulated human gene family. The gene product exhibits neurite outgrowth-promoting activity and may play a role in nervous system development and/or maintenance. Expression of MK is predominant only for a short period from approximately one-half to two-thirds of the way through gestation; before and after that, it is barely detectable.

Product Categories/Family for anti-MK antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 59894796
• NCBI GeneID: 4192
• NCBI Accession #: NP_001012333.1
• NCBI GenBank Nucleotide #: NM_001012333
• UniProt Accession #: P21741; Q2LEK4; Q9UCC7
• Molecular Weight: 9,512 Da
• NCBI Official Full Name: midkine isoform a
• NCBI Official Synonym Full Names: midkine (neurite growth-promoting factor 2)
• NCBI Official Symbol: MDK
• NCBI Official Synonym Symbols: MK; ARAP; NEGF2
• NCBI Protein Information: midkine; amphiregulin-associated protein; midgestation and kidney protein; neurite outgrowth-promoting factor 2; retinoic acid inducible factor
• UniProt Protein Name: Midkine
• Protein Family: Midkine
• UniProt Gene Name: MDK
• UniProt Synonym Gene Names: MK1; NEGF2; MK; ARAP
• UniProt Entry Name: MK_HUMAN

NCBI Description

This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012]

Uniprot Description

MDK: Developmentally regulated, secreted growth factor homologous to pleiotrophin (PTN), which has heparin binding activity. Binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1), followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase, and the induction of cell proliferation. Involved in neointima formation after arterial injury, possibly by mediating leukocyte recruitment. Also involved in early fetal adrenal gland development. Belongs to the pleiotrophin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: cell projection; cytoplasm; extracellular region

Molecular Function: heparin binding; growth factor activity

Biological Process: response to drug; nervous system development; cell migration; Notch signaling pathway; dentate gyrus development; behavioral fear response; cerebellar granular layer development; short-term memory; adrenal gland development; positive regulation of transcription, DNA-dependent; response to glucocorticoid stimulus; signal transduction; positive regulation of cell division; response to wounding; cerebral cortex development; negative regulation of neuron apoptosis; cell differentiation; defecation; regulation of behavior