Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human, Rat MGST2 Polyclonal Antibody | anti-MGST2 antibody

MGST2 Polyclonal Antibody

Gene Names
MGST2; GST2; MGST-II
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
MGST2; Polyclonal Antibody; MGST2 Polyclonal Antibody; GST2; MGST-II; microsomal glutathione S-transferase 2; anti-MGST2 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.82 mg/ml (varies by lot)
Sequence Length
147
Applicable Applications for anti-MGST2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human MGST2 (NP_002404.1).
Immunogen Sequence
FRAQQNCVEFYPIFIITLWMAGWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIAKKLRRQF
Positive Samples
U-937, PC-12
Cellular Location
Endoplasmic Reticulum Membrane, Microsome Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-MGST2 Polyclonal Antibody)

Related Product Information for anti-MGST2 antibody
The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes a protein which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 8kDa; 16kDa
Observed: 17kDa
NCBI Official Full Name
microsomal glutathione S-transferase 2 isoform 1
NCBI Official Synonym Full Names
microsomal glutathione S-transferase 2
NCBI Official Symbol
MGST2
NCBI Official Synonym Symbols
GST2; MGST-II
NCBI Protein Information
microsomal glutathione S-transferase 2
UniProt Protein Name
Microsomal glutathione S-transferase 2
UniProt Gene Name
MGST2
UniProt Synonym Gene Names
GST2; Microsomal GST-2
UniProt Entry Name
MGST2_HUMAN

NCBI Description

The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes a protein which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene. [provided by RefSeq, Feb 2011]

Uniprot Description

MGST2: Can catalyze the production of LTC4 from LTA4 and reduced glutathione. Can catalyze the conjugation of 1-chloro-2,4- dinitrobenzene with reduced glutathione. Belongs to the MAPEG family.

Protein type: Membrane protein, integral; Xenobiotic Metabolism - drug metabolism - cytochrome P450; EC 2.5.1.18; Endoplasmic reticulum; Membrane protein, multi-pass; Xenobiotic Metabolism - metabolism by cytochrome P450; Transferase; Other Amino Acids Metabolism - glutathione

Chromosomal Location of Human Ortholog: 4q28.3

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle; integral to membrane; plasma membrane; nuclear envelope

Molecular Function: glutathione transferase activity; leukotriene-C4 synthase activity; enzyme activator activity; glutathione peroxidase activity

Biological Process: leukotriene biosynthetic process; positive regulation of catalytic activity; xenobiotic metabolic process; glutathione biosynthetic process; response to lipopolysaccharide; response to organic nitrogen

Research Articles on MGST2

Similar Products

Product Notes

The MGST2 mgst2 (Catalog #AAA9140824) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MGST2 Polyclonal Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MGST2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the MGST2 mgst2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MGST2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual