Rabbit anti-Human, Rat MGST2 Polyclonal Antibody | anti-MGST2 antibody

MGST2 Polyclonal Antibody

Cat. Num. AAA9140824

• Gene Names: MGST2; GST2; MGST-II
• Reactivity: Human, Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: MGST2; Polyclonal Antibody; MGST2 Polyclonal Antibody; GST2; MGST-II; microsomal glutathione S-transferase 2; anti-MGST2 antibody

• Host: Rabbit
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 2.82 mg/ml (varies by lot)
• Sequence Length: 147

• Applicable Applications for anti-MGST2 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human MGST2 (NP_002404.1).
• Immunogen Sequence: FRAQQNCVEFYPIFIITLWMAGWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIAKKLRRQF
• Positive Samples: U-937, PC-12
• Cellular Location: Endoplasmic Reticulum Membrane, Microsome Membrane, Multi-Pass Membrane Protein
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-MGST2 Polyclonal Antibody)

Related Product Information for anti-MGST2 antibody

The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes a protein which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 324120893
• NCBI GeneID: 4258
• NCBI Accession #: NP_001191295.1
• NCBI GenBank Nucleotide #: NP_001191295.1
• UniProt Accession #: Q99735
• Molecular Weight: Calculated: 8kDa; 16kDa; Observed: 17kDa
• NCBI Official Full Name: microsomal glutathione S-transferase 2 isoform 1
• NCBI Official Synonym Full Names: microsomal glutathione S-transferase 2
• NCBI Official Symbol: MGST2
• NCBI Official Synonym Symbols: GST2; MGST-II
• NCBI Protein Information: microsomal glutathione S-transferase 2
• UniProt Protein Name: Microsomal glutathione S-transferase 2
• Protein Family: Microsomal glutathione S-transferase
• UniProt Gene Name: MGST2
• UniProt Synonym Gene Names: GST2; Microsomal GST-2
• UniProt Entry Name: MGST2_HUMAN

NCBI Description

The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes a protein which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene. [provided by RefSeq, Feb 2011]

Uniprot Description

MGST2: Can catalyze the production of LTC4 from LTA4 and reduced glutathione. Can catalyze the conjugation of 1-chloro-2,4- dinitrobenzene with reduced glutathione. Belongs to the MAPEG family.

Protein type: Membrane protein, integral; Xenobiotic Metabolism - drug metabolism - cytochrome P450; EC 2.5.1.18; Endoplasmic reticulum; Membrane protein, multi-pass; Xenobiotic Metabolism - metabolism by cytochrome P450; Transferase; Other Amino Acids Metabolism - glutathione

Chromosomal Location of Human Ortholog: 4q28.3

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle; integral to membrane; plasma membrane; nuclear envelope

Molecular Function: glutathione transferase activity; leukotriene-C4 synthase activity; enzyme activator activity; glutathione peroxidase activity

Biological Process: leukotriene biosynthetic process; positive regulation of catalytic activity; xenobiotic metabolic process; glutathione biosynthetic process; response to lipopolysaccharide; response to organic nitrogen