Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MGMTSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Rabbit MGMT Polyclonal Antibody | anti-MGMT antibody

MGMT antibody - middle region

Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MGMT; Polyclonal Antibody; MGMT antibody - middle region; anti-MGMT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGG
Sequence Length
207
Applicable Applications for anti-MGMT antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MGMT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MGMTSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MGMTSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-MGMT antibody
This is a rabbit polyclonal antibody against MGMT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MGMT is involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA.MGMT repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
methylated-DNA--protein-cysteine methyltransferase
NCBI Official Synonym Full Names
O-6-methylguanine-DNA methyltransferase
NCBI Official Symbol
MGMT
NCBI Protein Information
methylated-DNA--protein-cysteine methyltransferase
UniProt Protein Name
Methylated-DNA--protein-cysteine methyltransferase
UniProt Gene Name
MGMT
UniProt Synonym Gene Names
MGMT
UniProt Entry Name
MGMT_HUMAN

NCBI Description

Alkylating agents are potent carcinogens that can result in cell death, mutation and cancer. The protein encoded by this gene is a DNA repair protein that is involved in cellular defense against mutagenesis and toxicity from alkylating agents. The protein catalyzes transfer of methyl groups from O(6)-alkylguanine and other methylated moieties of the DNA to its own molecule, which repairs the toxic lesions. Methylation of the genes promoter has been associated with several cancer types, including colorectal cancer, lung cancer, lymphoma and glioblastoma. [provided by RefSeq, Sep 2015]

Uniprot Description

MGMT: Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA. Repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated. Belongs to the MGMT family.

Protein type: EC 2.1.1.63; Methyltransferase; Nuclear receptor co-regulator; DNA repair, damage; Apoptosis

Chromosomal Location of Human Ortholog: 10q26

Cellular Component: nucleoplasm; membrane; nucleus

Molecular Function: methyltransferase activity; DNA binding; methylated-DNA-[protein]-cysteine S-methyltransferase activity; damaged DNA binding; calcium ion binding; DNA-methyltransferase activity

Biological Process: response to drug; response to ethanol; positive regulation of DNA repair; DNA dealkylation; response to folic acid; response to toxin; DNA methylation; regulation of caspase activity; DNA repair; DNA ligation

Research Articles on MGMT

Similar Products

Product Notes

The MGMT mgmt (Catalog #AAA3206167) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MGMT antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's MGMT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MGMT mgmt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ISYQQLAALA GNPKAARAVG GAMRGNPVPI LIPCHRVVCS SGAVGNYSGG. It is sometimes possible for the material contained within the vial of "MGMT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.