Western Blot (WB)
(Western blot analysis of extracts of U-87MG cells, using MGAT4C antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Rabbit anti-Human MGAT4C Polyclonal Antibody | anti-MGAT4C antibody
MGAT4C Polyclonal Antibody
Gene Names
MGAT4C; GNTIVH; HGNT-IV-H
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
MGAT4C; Polyclonal Antibody; MGAT4C Polyclonal Antibody; GNTIVH; HGNT-IV-H; anti-MGAT4C antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
KNVIRFKPSLFQHMGYYSSYKGTENKLKDDDFEEESFDIPDNPPASLYTNMNVFENYEASKAYSSVDEYFWGKPPSTGDVFVIVFENPIIIKKIKVNTGTEDRQNDILHHGALDVGENVMPSKQRRQCSTYLRLGEFKNGNFEMSGVNQKIPFDIHCMRIYVTKTQKEWLIIRSISIWTS
Sequence Length
478
Applicable Applications for anti-MGAT4C antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human MGAT4C
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Golgi apparatus membrane, Single-pass type II membrane protein
Positive Samples
U-87MG
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of U-87MG cells, using MGAT4C antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of U-87MG cells, using MGAT4C antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Product Categories/Family for anti-MGAT4C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 56kDa; 59kDa
Observed: 56kDa
Observed: 56kDa
NCBI Official Full Name
alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C isoform c
NCBI Official Synonym Full Names
MGAT4 family member C
NCBI Official Symbol
MGAT4C
NCBI Official Synonym Symbols
GNTIVH; HGNT-IV-H
NCBI Protein Information
alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C
UniProt Protein Name
Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C
UniProt Gene Name
MGAT4C
UniProt Synonym Gene Names
hGnT-IV-H; GlcNAc-T IVc; GnT-IVc; N-acetylglucosaminyltransferase IVc
Uniprot Description
Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains (). Does not catalyze the transfer of GlcNAc to the Manalpha1-6 arm to form GlcNAcBeta1-4Manalpha1-6 linkage ('GnT-VI' activity).
Research Articles on MGAT4C
Similar Products
Product Notes
The MGAT4C mgat4c (Catalog #AAA9134331) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MGAT4C Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MGAT4C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the MGAT4C mgat4c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KNVIRFKPSL FQHMGYYSSY KGTENKLKDD DFEEESFDIP DNPPASLYTN MNVFENYEAS KAYSSVDEYF WGKPPSTGDV FVIVFENPII IKKIKVNTGT EDRQNDILHH GALDVGENVM PSKQRRQCST YLRLGEFKNG NFEMSGVNQK IPFDIHCMRI YVTKTQKEWL IIRSISIWTS. It is sometimes possible for the material contained within the vial of "MGAT4C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
