Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '26668'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
2.17 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '26668' and pd.language_id = 1
Query
Database
1.54 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26668'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
2.05 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '26668'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '26668' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26668'
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (68) "Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)"
$value['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value['app_notes']
⇄⧉testing_protocols => string (1098) "IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to LMNB1 ...
$value['testing_protocols']
IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to LMNB1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26668_IF6.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of LMNB1 transfected lysate using anti-LMNB1 monoclonal antibody and Protein A Magnetic Bead (<a href="products_detail.asp?Catalog_id=U0007">U0007</a>), and immunoblotted with LMNB1 MaxPab rabbit polyclonal antibody.||AAA26668_IP5.jpg!!WB (Western Blot)||Western Blot analysis of LMNB1 expression in transfected 293T cell line by LMNB1 monoclonal antibody (M01), clone 4B10.<br><br>Lane 1: LMNB1 transfected lysate (66.4 KDa).<br>Lane 2: Non-transfected lysate.<br>||AAA26668_WB4.jpg!!WB (Western Blot)||LMNB1 monoclonal antibody (M01), clone 4B10. Western Blot analysis of LMNB1 expression in Raw 264.7.||AAA26668_WB3.jpg!!WB (Western Blot)||LMNB1 monoclonal antibody (M01), clone 4B10. Western Blot analysis of LMNB1 expression in NIH/3T3.||AAA26668_WB2.jpg!!WB (Western Blot)||LMNB1 monoclonal antibody (M01), clone 4B10. Western Blot analysis of LMNB1 expression in Jurkat (Cat # L017V1).||AAA26668_WB.jpg
⇄⧉products_description => string (530) "The nuclear lamina consists of a two-dimensional matrix of proteins located ...
$value['products_description']
The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. [provided by RefSeq]
⇄products_references => string (3) "N/A"
$value['products_references']
⇄⧉products_related_diseases => string (239) "Nervous System Diseases||27!!Pelizaeus-Merzbacher Disease||7!!Adenocarcinoma...
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value->a['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value->a['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value->a['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (68) "Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)"
$value->a['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value->a['app_notes']
⇄⧉testing_protocols => string (1098) "IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to LMNB1 ...
$value->a['testing_protocols']
IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to LMNB1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26668_IF6.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of LMNB1 transfected lysate using anti-LMNB1 monoclonal antibody and Protein A Magnetic Bead (<a href="products_detail.asp?Catalog_id=U0007">U0007</a>), and immunoblotted with LMNB1 MaxPab rabbit polyclonal antibody.||AAA26668_IP5.jpg!!WB (Western Blot)||Western Blot analysis of LMNB1 expression in transfected 293T cell line by LMNB1 monoclonal antibody (M01), clone 4B10.<br><br>Lane 1: LMNB1 transfected lysate (66.4 KDa).<br>Lane 2: Non-transfected lysate.<br>||AAA26668_WB4.jpg!!WB (Western Blot)||LMNB1 monoclonal antibody (M01), clone 4B10. Western Blot analysis of LMNB1 expression in Raw 264.7.||AAA26668_WB3.jpg!!WB (Western Blot)||LMNB1 monoclonal antibody (M01), clone 4B10. Western Blot analysis of LMNB1 expression in NIH/3T3.||AAA26668_WB2.jpg!!WB (Western Blot)||LMNB1 monoclonal antibody (M01), clone 4B10. Western Blot analysis of LMNB1 expression in Jurkat (Cat # L017V1).||AAA26668_WB.jpg
⇄⧉products_description => string (530) "The nuclear lamina consists of a two-dimensional matrix of proteins located ...
$value->a['products_description']
The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. [provided by RefSeq]
⇄products_references => string (3) "N/A"
$value->a['products_references']
⇄⧉products_related_diseases => string (239) "Nervous System Diseases||27!!Pelizaeus-Merzbacher Disease||7!!Adenocarcinoma...
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value->d['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value->d['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value->d['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (68) "Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)"
$value->d['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value->d['app_notes']
⇄⧉testing_protocols => string (1098) "IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to LMNB1 ...
$value->d['testing_protocols']
IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to LMNB1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26668_IF6.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of LMNB1 transfected lysate using anti-LMNB1 monoclonal antibody and Protein A Magnetic Bead (<a href="products_detail.asp?Catalog_id=U0007">U0007</a>), and immunoblotted with LMNB1 MaxPab rabbit polyclonal antibody.||AAA26668_IP5.jpg!!WB (Western Blot)||Western Blot analysis of LMNB1 expression in transfected 293T cell line by LMNB1 monoclonal antibody (M01), clone 4B10.<br><br>Lane 1: LMNB1 transfected lysate (66.4 KDa).<br>Lane 2: Non-transfected lysate.<br>||AAA26668_WB4.jpg!!WB (Western Blot)||LMNB1 monoclonal antibody (M01), clone 4B10. Western Blot analysis of LMNB1 expression in Raw 264.7.||AAA26668_WB3.jpg!!WB (Western Blot)||LMNB1 monoclonal antibody (M01), clone 4B10. Western Blot analysis of LMNB1 expression in NIH/3T3.||AAA26668_WB2.jpg!!WB (Western Blot)||LMNB1 monoclonal antibody (M01), clone 4B10. Western Blot analysis of LMNB1 expression in Jurkat (Cat # L017V1).||AAA26668_WB.jpg
⇄⧉products_description => string (530) "The nuclear lamina consists of a two-dimensional matrix of proteins located ...
$value->d['products_description']
The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. [provided by RefSeq]
⇄products_references => string (3) "N/A"
$value->d['products_references']
⇄⧉products_related_diseases => string (239) "Nervous System Diseases||27!!Pelizaeus-Merzbacher Disease||7!!Adenocarcinoma...
⇄⧉specificity => string (177) "This assay has high sensitivity and excellent specificity for detection of T...
$value[0]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of TGF-beta. No significant cross-reactivity or interference between TGF-beta and analogues was observed.
⇄purity => string (3) "N/A"
$value[0]['_source']['purity']
⇄form => string (3) "N/A"
$value[0]['_source']['form']
⇄concentration => string (3) "N/A"
$value[0]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[0]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉etc_term1 => string (151) "Assay Type||Sandwich!!Samples||Serum, plasma, tissue homogenates and other b...
$value[0]['_source']['etc_term1']
Assay Type||Sandwich!!Samples||Serum, plasma, tissue homogenates and other biological fluids!!Detection Range||31.25-2000pg/ml!!Sensitivity||18.75pg/ml
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[0]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄⧉search_terms => string (379) "aaa27553 hamster this assay has high sensitivity and excellent specificity f...
$value[0]['_source']['search_terms']
aaa27553 hamster this assay has high sensitivity and excellent specificity for detection of tgf beta no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa27553_sc elisa kit transforming growth factor partial 1 tgfb1 ced lap dpd1 tgfb tgfbeta 44,341 da 339558 aaa36735.1 p01137 q9ucg4 a8k792 partial1
⇄⧉specificity => string (179) "This assay has high sensitivity and excellent specificity for detection of T...
$value[1]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of TGF-beta1. No significant cross-reactivity or interference between TGF-beta1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[1]['_source']['purity']
⇄form => string (3) "N/A"
$value[1]['_source']['form']
⇄concentration => string (3) "N/A"
$value[1]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[1]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉etc_term1 => string (151) "Assay Type||Sandwich!!Samples||Serum, plasma, tissue homogenates and other b...
$value[1]['_source']['etc_term1']
Assay Type||Sandwich!!Samples||Serum, plasma, tissue homogenates and other biological fluids!!Detection Range||31.25-2000pg/ml!!Sensitivity||18.75pg/ml
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[1]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄⧉search_terms => string (548) "aaa17377 human this assay has high sensitivity and excellent specificity for...
$value[1]['_source']['search_terms']
aaa17377 human this assay has high sensitivity and excellent specificity for detection of tgfbeta1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17377_sc elisa kit transforming growth factor beta 1 tgf b1 tgfb tgfbeta ced dpd1 tgfb1 partial lap 44,341 da tgfb1_human 33431110 aaq18642.1 p01137 q9ucg4 a8k792 131300 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 31.25 2000pg ml 18.75 pg intra precision cv beta1
⇄⧉specificity => string (388) "This assay has high sensitivity and excellent specificity for detection of T...
$value[2]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of TGF-beta. No significant cross-reactivity or interference between TGF-beta and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between TGF-beta and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[2]['_source']['purity']
⇄form => string (3) "N/A"
$value[2]['_source']['form']
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉products_description => string (1436) "Intended Uses: This TGF-beta ELISA kit is a 1.5 hour solid-phase ELISA desig...
$value[2]['_source']['products_description']
Intended Uses: This TGF-beta ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Bovine TGF-beta. This ELISA kit for research use only, not for therapeutic or test applications!<br><br>Principle of the Assay: TGF-beta ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-TGF-beta antibody and an TGF-beta-HRP conjugate. The assay sample and buffer are incubated together with TGF-beta-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the TGF-beta concentration since TGF-beta from samples and TGF-beta-HRP conjugate compete for the anti-TGF-beta antibody binding site. Since the number of sites is limited, as more sites are occupied by TGF-beta from the sample, fewer sites are left to bind TGF-beta-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The TGF-beta concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (618) "aaa16752 bovine this assay has high sensitivity and excellent specificity fo...
$value[2]['_source']['search_terms']
aaa16752 bovine this assay has high sensitivity and excellent specificity for detection of tgf beta no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16752_sc elisa kit transforming growth factor b tgfbeta tgfb partial 4,760 da tgfbi c7ffs5_human 254596903 act75673.1 cancer samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive 1.0 pg ml competitive1.0
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||5-2000ng/L!!Sensitivity||2.76ng/L
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[3]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (926) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[3]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Mouse TGF-beta antibody. TGF-beta present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Mouse TGF-beta Antibody is added and binds to TGF-beta in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated TGF-beta antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Mouse TGF-beta. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Mouse Transforming growth factor beta (also known as TGF-beta) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄⧉search_terms => string (570) "aaa11087 mouse typical testing data standard curve for reference only aaa110...
$value[3]['_source']['search_terms']
aaa11087 mouse typical testing data standard curve for reference only aaa11087_sc elisa kit transforming growth factor beta tgf partial 1 tgfb1 ced lap dpd1 tgfb tgfbeta 44,341 da 339558 aaa36735.1 p01137 q9ucg4 a8k792 samples serum plasma cell culture supernates ascites tissue homogenates or other biological fluids assay type quantitative sandwich detection range 5 2000ng l sensitivity 2.76ng intra precision within an three of known concentration were tested on one plate to assess cv<8 inter between assays in separate cv = sd mean x 100 cv<10 partial1 range5 x100
⇄⧉specificity => string (391) "This assay has high sensitivity and excellent specificity for detection of T...
$value[4]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of TGF-beta1. No significant cross-reactivity or interference between TGF-beta1 and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between TGF-beta1 and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[4]['_source']['purity']
⇄form => string (3) "N/A"
$value[4]['_source']['form']
⇄concentration => string (3) "N/A"
$value[4]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉products_description => string (1449) "Intended Uses: This TGF-beta1 ELISA kit is a 1.5 hour solid-phase ELISA desi...
$value[4]['_source']['products_description']
Intended Uses: This TGF-beta1 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Bovine TGF-beta1. This ELISA kit for research use only, not for therapeutic or test applications!<br><br>Principle of the Assay: TGF-beta1 ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-TGF-beta1 antibody and an TGF-beta1-HRP conjugate. The assay sample and buffer are incubated together with TGF-beta1-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the TGF-beta1 concentration since TGF-beta1 from samples and TGF-beta1-HRP conjugate compete for the anti-TGF-beta1 antibody binding site. Since the number of sites is limited, as more sites are occupied by TGF-beta1 from the sample, fewer sites are left to bind TGF-beta1-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The TGF-beta1 concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (715) "aaa16964 bovine this assay has high sensitivity and excellent specificity fo...
$value[4]['_source']['search_terms']
aaa16964 bovine this assay has high sensitivity and excellent specificity for detection of tgf beta1 no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16964_sc elisa kit transforming growth factor b1 tgfbeta1 tgfb1 beta 1 ced lap dpd1 tgfb tgfbeta latency associated peptide prepro 44,341 da tgfb1_human 63025222 np_000651.3 p01137 nm_000660.5 q9ucg4 a8k792 190180 cancer samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive 1.0 pg ml competitive1.0
⇄⧉specificity => string (189) "This assay has high sensitivity and excellent specificity for detection of m...
$value[5]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of mouse TGFbeta2. No significant cross-reactivity or interference between mouse TGFbeta2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[5]['_source']['purity']
⇄form => string (3) "N/A"
$value[5]['_source']['form']
⇄concentration => string (3) "N/A"
$value[5]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[5]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (326) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[5]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (747) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[5]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for TGFbeta2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any TGFbeta2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for TGFbeta2 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of TGFbeta2 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (593) "aaa15056 mouse this assay has high sensitivity and excellent specificity for...
$value[5]['_source']['search_terms']
aaa15056 mouse this assay has high sensitivity and excellent specificity for detection of tgfbeta2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15056_td elisa kit transforming growth factor beta 3 beta3 tgf arvd flj16571 tgfb3 tgfb 46,885 da lap tgfb3_mouse 135685 p17125.1 p17125 samples serum plasma tissue homogenates type quantitative sandwich range 1.56 pg ml 100 0.39 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in ml100
⇄⧉specificity => string (189) "This assay has high sensitivity and excellent specificity for detection of m...
$value[6]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of mouse TGFbeta2. No significant cross-reactivity or interference between mouse TGFbeta2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[6]['_source']['purity']
⇄form => string (3) "N/A"
$value[6]['_source']['form']
⇄concentration => string (3) "N/A"
$value[6]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[6]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[6]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (747) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[6]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for TGFbeta2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any TGFbeta2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for TGFbeta2 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of TGFbeta2 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[6]['_source']['products_references']
⇄⧉products_related_diseases => string (205) "Fibrosis||270!!Inflammation||177!!Necrosis||171!!Nervous System Diseases||12...
$value[6]['_source']['products_related_diseases']
Fibrosis||270!!Inflammation||177!!Necrosis||171!!Nervous System Diseases||120!!Cardiovascular Diseases||117!!Glaucoma||104!!Heart Diseases||57!!Breast Neoplasms||55!!Liver Diseases||53!!Kidney Diseases||51
⇄⧉search_terms => string (637) "aaa15433 mouse this assay has high sensitivity and excellent specificity for...
$value[6]['_source']['search_terms']
aaa15433 mouse this assay has high sensitivity and excellent specificity for detection of tgfbeta2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15433_td elisa kit transforming growth factor beta 2 factorbeta2 mgc116892 tgf beta2 tgfb2 tgfb bb105277 47,589 da lap tgfb2_mouse 166706905 np_033393.2 p27090 nm_009367.3 q91vp5 samples serum plasma tissue homogenates type quantitative sandwich range 1.56 pg ml 100 < 0.39 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in ml100
Samples||cell culture supernates, serum, plasma (EDTA) and urine!!Detection Range||15.6pg/ml-1000pg/ml!!Sensitivity||< 1pg/ml
⇄⧉etc_term2 => string (341) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[7]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision.!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision.
⇄⧉products_description => string (2274) "Principle of the Assay: The rat TGF? 1 ELISA Kit was based on standard sandw...
$value[7]['_source']['products_description']
Principle of the Assay: The rat TGF? 1 ELISA Kit was based on standard sandwich enzyme-linked immune-sorbent assay technology. A monoclonal antibody from mouse specific for TGF? 1 has been precoated onto 96-well plates. Standards (Expression system for standard: CHO, Immunogen sequence: A279-S390) and test samples are added to the wells, a biotinylated detection polyclonal antibody from goat specific for TGF? 1 is added subsequently and then followed by washing with PBS or TBS buffer. Avidin-Biotin-Peroxidase Complex was added and unbound conjugates were washed away with PBS or TBS buffer. HRP substrate TMB was used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the rat TGF? 1 amount of sample captured in plate.<br><br>Background: Transforming growth factor-beta1 (TGF-beta1) is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGF-beta and essentially all of them have specific receptors for this peptide. TGF-beta regulates the actions of many other peptide growth factors and determines a positive or negative direction of their effects.TGFbeta1 is known for its potent and diverse biological effects, including immune regulation, and cell growth and differentiation.TGFbeta1 is also an important mediator of bone remodeling.TGFbeta1, a potent keratinocyte growth inhibitor, has been shown to be overexpressed in keratinocytes in certain inflammatory skin diseases and has been thought to counteract the effects of other growth factors at the site of inflammation.TGF-beta1, a multifunctional cytokine with fibrogenic properties, has been implicated in the pathogenesis of the vascular and target organ complications of hypertension. TGF-beta1 may also regulate blood pressure via stimulation of endothelin-1 and/or renin secretion.TGFbeta1 is secreted as a latent form, which consists of its mature form and a latency-associated peptide (beta1-LAP) in either the presence or the absence of additional latent TGF-beta1-binding protein.The standard product used in this kit is recombinant TGF? 1 with the molecular mass of 25KDa.
⇄⧉search_terms => string (607) "aaa11539 rat natural and recombinant tgf? 1 typical testing data standard cu...
$value[7]['_source']['search_terms']
aaa11539 rat natural and recombinant tgf? 1 typical testing data standard curve for reference only aaa11539_sc elisa kit tgf beta picokine transforming growth factor camurati engelmann disease
ced
dpd1
lap
latency associated peptide
tgf protein
tgfb
tgfb1
tgfb1_human
tgfbeta
transforming tgfb1 tgfb 44,329 da lap tgfb1_rat 135677 p17246.1 p17246 q53ym8 samples cell culture supernates serum plasma edta urine detection range 15.6pg ml 1000pg sensitivity < 1pg intra assay precision within an three of known concentration were tested on one plate to assess inter between assays in separate tgf?1
⇄⧉specificity => string (187) "This assay has high sensitivity and excellent specificity for detection of d...
$value[8]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of dog TGF-beta1. No significant cross-reactivity or interference between dog TGF-beta1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[8]['_source']['purity']
⇄form => string (3) "N/A"
$value[8]['_source']['form']
⇄concentration => string (3) "N/A"
$value[8]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[8]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[8]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (751) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[8]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for TGF-beta1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any TGF-beta1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for TGF-beta1 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of TGF-beta1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (652) "aaa15269 dog this assay has high sensitivity and excellent specificity for d...
$value[8]['_source']['search_terms']
aaa15269 dog this assay has high sensitivity and excellent specificity for detection of tgf beta1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15269_td elisa kit transforming growth factor beta 1 ced dpd1 lap tgfb tgfbeta protein latency associated peptide tgfb1 camurati engelmann disease 44,185 da tgfb1_canfa 50979134 np_001003309.1 p54831 nm_001003309.1 samples serum plasma type quantitative sandwich range 0.781 ng ml 50 <0.747 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in ml50
⇄⧉specificity => string (173) "This assay has high sensitivity and excellent specificity for detection of T...
$value[9]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of TGF-?1. No significant cross-reactivity or interference between TGF-?1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[9]['_source']['purity']
⇄form => string (3) "N/A"
$value[9]['_source']['form']
⇄concentration => string (3) "N/A"
$value[9]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[9]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
Assay Type||Sandwich ELISA, Double Antibody!!Samples||Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples!!Detection Range||31.25-2000pg/ml!!Sensitivity||18.75pg/ml
⇄⧉etc_term2 => string (419) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[9]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level TGF- ?1 were tested 20 times on one plate, respectively. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level TGF-?1 were tested on 3 different plates, 8 replicates in each plate. CV (%) = SD/meanX100. Inter-Assay: CV<10%
⇄⧉products_description => string (843) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[9]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Anti- TGF-?1 antibody was pre-coated onto 96-well plates. And the biotin conjugated anti- TGF-?1 antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the TGF-?1 amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of TGF-?1 can be calculated.
⇄⧉search_terms => string (507) "aaa17522 monkey this assay has high sensitivity and excellent specificity fo...
$value[9]['_source']['search_terms']
aaa17522 monkey this assay has high sensitivity and excellent specificity for detection of tgf ?1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17522_sc elisa kit transforming growth factor beta1 b1 beta 1 preproprotein tgfb1 ced lap dpd1 tgfb tgfbeta 44,341 da tgfb1_human 63025222 np_000651.3 p01137 nm_000660.5 q9ucg4 a8k792 131300 samples serum plasma tissue homogenates other biological fluids range 31.25 2000pg ml
<b>Storage:</b><br>Avoid repeated freeze/thaw cycles.<br>Store at 4 degree C for frequent use.<br>Aliquot and store at -20 degree C for 24 months.<br><br><b>Stability Test:</b><br>thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Western blotting: 0.5-3ug/mL<br>Immunohistochemistry: 5-30ug/mL<br>Immunocytochemistry: 5-30ug/mL<br>Optimal working dilutions must be determined by end user.
⇄⧉testing_protocols => string (778) "IHC (Immunohistchemistry)||DAB staining on IHC-P; Samples: Mouse Small intes...
aaa20909 rabbit mouse polyclonal antigen specific affinity chromatography followed by protein a supplied as solution form in 0.01m pbs ph7.4 containing 0.05 proclin 300 50 glycerol the antibody is raised against ltbp1 it has beenselected for its ability to recognize immunohistochemical staining andwestern blotting wb ihc icc ip western 0.5 2 ug ml 1:210 860 immunohistochemistry 5 20 1:21 86 immunocytochemistry optimal working dilutions must be determined end user blot lane1 liver tissue lane2 placenta lane3 spleen aaa20909_wb sample recombinant aaa20909_wb2 dab on p samples intestine aaa20909_ihc heart aaa20909_ihc2 skeletal muscle aaa20909_ihc3 latent transforming growth factor beta binding 1 isoform 7 tgfb ltbp ltbp1l 9830146m04 b2b1000clo 9430031g15rik tgf beta1 bp 1063759631 np_001318166.1 q8cg19 nm_001331237.1 o88349 q505c9 q8bnw7 q8c7f5 q8cg18 q8cir0 b1b1d9 b1b1e1 organism species mus musculus source preparation traits liquid immunogen asp1415~glu1712 expressed e.coli cross reactivity conjugate no e coli conjugated apc version of this item also available catalog #mbs2063432 proclin300 western0.5 1:210860 immunohistochemistry5 1:2186 binding1 isoform7
⇄⧉specificity => string (196) "The Mouse TGF beta 1 ELISA Kit allows for the detection and quantification o...
$value[11]['_source']['specificity']
The Mouse TGF beta 1 ELISA Kit allows for the detection and quantification of endogenous levels of natural and/or recombinant Mouse TGF beta 1 proteins within the range of 15.6 pg/ml - 1000 pg/ml.
⇄purity => string (3) "N/A"
$value[11]['_source']['purity']
⇄form => string (3) "N/A"
$value[11]['_source']['form']
⇄concentration => string (3) "N/A"
$value[11]['_source']['concentration']
⇄⧉storage_stability => string (107) "Shipped and store at 4 degree C for 6 months, store at -20 degree C for one ...
$value[11]['_source']['storage_stability']
Shipped and store at 4 degree C for 6 months, store at -20 degree C for one year. Avoid freeze/thaw cycles.
⇄⧉products_description => string (2249) "Background: Transforming growth factor-beta 1 (TGF-beta 1) is a multifunctio...
$value[11]['_source']['products_description']
Background: Transforming growth factor-beta 1 (TGF-beta 1) is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGF-beta and essentially all of them have specific receptors for this peptide. TGF-beta regulates the actions of many other peptide growth factors and determines a positive or negative direction of their effects. TGF beta 1 is known for its potent and diverse biological effects, including immune regulation, and cell growth and differentiation. TGF beta 1 is also an important mediator of bone remodeling. TGF beta 1, a potent keratinocyte growth inhibitor, has been shown to be overexpressed in keratinocytes in certain inflammatory skin diseases and has been thought to counteract the effects of other growth factors at the site of inflammation. TGF-beta 1, a multifunctional cytokine with fibrogenic properties, has been implicated in the pathogenesis of the vascular and target organ complications of hypertension. TGF-beta 1 may also regulate blood pressure via stimulation of endothelin-1 and/or renin secretion. TGF beta 1 is secreted as a latent form, which consists of its mature form and a latency-associated peptide (beta 1-LAP) in either the presence or the absence of additional latent TGF-beta 1-binding protein.<br><br>Principle of the Assay: The Mouse TGF beta 1 ELISA (Enzyme-Linked Immunosorbent Assay) kit is an in vitro enzyme-linked immunosorbent assay for the quantitative measurement of Mouse TGF beta 1 in Cell Culture Supernatants, Serum, Plasma, Tissue Homogenates. This assay employs an antibody specific for Mouse TGF beta 1 coated on a 96-well plate. Standards and samples are pipetted into the wells and TGF beta 1 present in a sample is bound to the wells by the immobilized antibody. The wells are washed and biotinylated anti-Mouse TGF beta 1 antibody is added. After washing away unbound biotinylated antibody, HRP-conjugated streptavidin is pipetted to the wells. The wells are again washed, a TMB substrate solution is added to the wells and color develops in proportion to the amount of TGF beta 1 bound. The Stop Solution changes the color from blue to yellow, and the intensity of the color is measured at 450 nm.
⇄⧉search_terms => string (464) "aaa17897 mouse the tgf beta 1 elisa kit allows for detection and quantificat...
$value[11]['_source']['search_terms']
aaa17897 mouse the tgf beta 1 elisa kit allows for detection and quantification of endogenous levels natural or recombinant proteins within range 15.6 pg ml 1000 sandwich se typical testing data standard curve reference only aaa17897_sc tgfb transforming growth factor tgfb1 tgfbeta1 beta1 regulatory protein 44,310 da lap tgfb1_mouse 6755775 np_035707.1 p04202 nm_011577.1 samples cell culture supernatants serum plasma tissue homogenates urine sensitivity < 2 <2
⇄⧉specificity => string (191) "This assay has high sensitivity and excellent specificity for detection of h...
$value[12]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human TGF-beta3. No significant cross-reactivity or interference between human TGF-beta3 and analogues was observed.
⇄purity => string (3) "N/A"
$value[12]['_source']['purity']
⇄form => string (3) "N/A"
$value[12]['_source']['form']
⇄concentration => string (3) "N/A"
$value[12]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[12]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[12]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (751) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[12]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for TGF-beta3 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any TGF-beta3 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for TGF-beta3 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of TGF-beta3 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (548) "aaa15414 human this assay has high sensitivity and excellent specificity for...
$value[12]['_source']['search_terms']
aaa15414 human this assay has high sensitivity and excellent specificity for detection of tgf beta3 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15414_td elisa kit transforming growth factor beta 3 arvd flj16571 tgfb3 preproprotein rnhf arvd1 prepro 47,328 da lap tgfb3_human 4507465 np_003230.1 p10600 nm_003239.3 gene 615582 samples serum plasma cell culture supernates type quantitative sandwich range 15.6 pg ml 1000 < 3.9 intra precision within an cv <3.9
⇄⧉specificity => string (79) "Specifically recognize TGF-beta, no obvious cross reaction with other analog...
$value[13]['_source']['specificity']
Specifically recognize TGF-beta, no obvious cross reaction with other analogues
⇄purity => string (3) "N/A"
$value[13]['_source']['purity']
⇄form => string (3) "N/A"
$value[13]['_source']['form']
⇄concentration => string (3) "N/A"
$value[13]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[13]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
Assay Type||Sandwich!!Samples||Serum, plasma, cell culture supernatant and other biological samples!!Detection Range||31.25-2000pg/ml!!Sensitivity||18.75pg/ml
⇄⧉etc_term2 => string (270) "Intra-assay Precision||Intra-assay Precision: samples with low, medium and h...
$value[13]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision: samples with low, medium and high concentration are tested 20 times on same plate.!!Inter-assay Precision||Inter-assay Precision: samples with low, medium and high concentration are tested 20 times on three different plates.
Background: Transforming growth factor-beta (TGF-beta) superfamily members are important regulatory molecules in cell proliferation, differentiation, development pattern determination and morphogenesis, as well as disease pathologic processes. There are three members of the TGF-beta family, called TGF-beta1, TGF-beta2, and TGF-beta3, respectively, which are encoded by different genes and expressed in a tissue-specific manner. The TGF-beta protein is synthesized as a precursor protein, which is cleaved and activated to reassemble and then binds to other proteins to form a latent complex. Activation occurs during proteolytic release of TGF-beta monomers, resulting in dimerization into mature TGF-beta ligands.<br><br>Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Anti TGF-beta antibody was pre-coated onto the 96-well plate. The biotin conjugated anti TGF-beta antibody was used as the detection antibody. The standards and pilot samples were added to the wells subsequently. After incubation, unbound conjugates were removed by wash buffer. Then, biotinylated detection antibody was added to bind with TGF-beta conjugated on coated antibody. After washing off unbound conjugates, HRP-Streptavidin was added. After a third washing, TMB substrates were added to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that turned yellow after adding a stop solution. Read the O.D. absorbance at 450nm in a microplate reader. The concentration of TGF-beta in the sample was calculated by drawing a standard curve. The concentration of the target substance is proportional to the OD450 value.
⇄⧉search_terms => string (572) "aaa17745 bovine this assay has high sensitivity and excellent specificity fo...
$value[13]['_source']['search_terms']
aaa17745 bovine this assay has high sensitivity and excellent specificity for detection of tgf beta no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17745_sc elisa kit transforming growth factor bone morphogenetic protein 7 bmp7 op 1 49,313 da osteogenic inn eptotermin alfa op1 bmp bmp7_human 339564 aaa36738.1 p18075 q9h512 q9ntq7 112267 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 31.25 2000pg ml 18.75pg intra precision cv protein7
⇄specificity => string (25) "Recognizes human TSC22D3."
$value[14]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[14]['_source']['purity']
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[14]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[14]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[14]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[14]['_source']['app_notes']
⇄⧉testing_protocols => string (981) "WB (Western Blot)||Western Blot detection against Immunogen (36.41kD).||AAA2...
$value[14]['_source']['testing_protocols']
WB (Western Blot)||Western Blot detection against Immunogen (36.41kD).||AAA25873_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged TSC22D3 is ~0.03ng/ml as a capture antibody.||AAA25873_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of TSC22D3 transfected lysate using TSC22D3 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TSC22D3 rabbit polyclonal antibody.||AAA25873_IP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to TSC22D3 on HeLa cell. [antibody concentration 10ug/ml].||AAA25873_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to TSC22D3 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml].||AAA25873_IHC2.jpg!!WB (Western Blot)||Western Blot analysis of TSC22D3 expression in transfected 293T cell line by TSC22D3 monoclonal antibody. Lane 1: TSC22D3 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.||AAA25873_WB.jpg
⇄⧉etc_term1 => string (266) "Immunogen||Partial recombinant corresponding to aa1-97 from human TSC22D3 (N...
$value[14]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa1-97 from human TSC22D3 (NP_932174) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT!!Conjugate||PE
⇄etc_term2 => string (3) "N/A"
$value[14]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[14]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[14]['_source']['products_weight']
⇄products_status => boolean true
$value[14]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[14]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "600"
$value[14]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[14]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[14]['_source']['language_id']
⇄products_name => string (7) "TSC22D3"
$value[14]['_source']['products_name']
⇄⧉products_name_oem => string (244) "TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zippe...
$value[14]['_source']['products_name_oem']
TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) (PE)
⇄⧉search_terms => string (1282) "aaa25873 mouse human monoclonal igg1,k 3a5 purified by protein a affinity ch...
$value[14]['_source']['search_terms']
aaa25873 mouse human monoclonal igg1,k 3a5 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes tsc22d3 elisa eia immunofluorescence if immunohistochemistry ihc immunoprecipitation ip western blot wb 10ug ml applications are based on unconjugated antibody analysis of expression transfected 293t cell line lane 1 lysate 22.2kd 2 non aaa25873_wb immunoperoxidase to formalin fixed paraffin embedded lymph node concentration 3ug aaa25873_ihc2 hela aaa25873_if3 using and magnetic bead immunoblotted rabbit polyclonal aaa25873_ip4 testing data detection limit for recombinant gst tagged is ~0.03ng capture aaa25873_td5 against immunogen 36.41kd aaa25873_wb6 tsc22 domain family 3 glucocorticoid induced leucine zipper delta sleep inducing peptide immunoreactor dsip immunoreactive dip tsc 22 like related 22r dsipi gilz isoform member hdip immunore predicted kda t22d3_human 37622903 np_932174 q99576 nm_198057 q5h9s3 q5jri9 q6fih6 q8nai1 q8wvb9 q9ubn5 q9ug13 300506 antibodies apoptosis partial corresponding aa1 97 from tag mw the alone 26kd sequence maqskldcrspvgldccnccldlahrsglqrgssgennnpgsptvsnfrqlqeklvfenlntdklnsimrqdslepvlrdpcylinegicnrnidqt conjugate ph7.2 lane1 22.2kd2 family3 aa197
⇄specificity => string (25) "Recognizes human TSC22D3."
$value[15]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[15]['_source']['purity']
⇄⧉form => string (99) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alk...
$value[15]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
⇄concentration => string (3) "N/A"
$value[15]['_source']['concentration']
⇄⧉storage_stability => string (304) "Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 mont...
$value[15]['_source']['storage_stability']
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[15]['_source']['app_notes']
⇄⧉testing_protocols => string (218) "WB (Western Blot)||Western Blot analysis of TSC22D3 expression in transfecte...
$value[15]['_source']['testing_protocols']
WB (Western Blot)||Western Blot analysis of TSC22D3 expression in transfected 293T cell line by TSC22D3 monoclonal antibody. Lane 1: TSC22D3 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.||AAA24395_WB.jpg
⇄⧉etc_term1 => string (266) "Immunogen||Partial recombinant corresponding to aa1-97 from human TSC22D3 (N...
$value[15]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa1-97 from human TSC22D3 (NP_932174) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT!!Conjugate||AP
⇄etc_term2 => string (3) "N/A"
$value[15]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[15]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[15]['_source']['products_weight']
⇄products_status => boolean true
$value[15]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[15]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "600"
$value[15]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[15]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[15]['_source']['language_id']
⇄products_name => string (7) "TSC22D3"
$value[15]['_source']['products_name']
⇄⧉products_name_oem => string (244) "TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zippe...
$value[15]['_source']['products_name_oem']
TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) (AP)
⇄⧉search_terms => string (1299) "aaa24395 mouse human monoclonal igg1,k 3a5 purified by protein a affinity ch...
$value[15]['_source']['search_terms']
aaa24395 mouse human monoclonal igg1,k 3a5 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with alkaline phosphatase ap recognizes tsc22d3 elisa eia immunohistochemistry ihc immunoprecipitation ip western blot wb applications are based on unconjugated antibody analysis of expression transfected 293t cell line lane 1 lysate 22.2kd 2 non mbs6007829_wb immunoperoxidase to formalin fixed paraffin embedded lymph node concentration 3ug ml mbs6007829_ihc2 immunofluorescence if hela 10ug mbs6007829_if3 using and magnetic bead immunoblotted rabbit polyclonal mbs6007829_ip4 testing data detection limit for recombinant gst tagged is ~0.03ng capture mbs6007829_td5 against immunogen 36.41kd mbs6007829_wb6 tsc22 domain family 3 glucocorticoid induced leucine zipper delta sleep inducing peptide immunoreactor dsip immunoreactive dip tsc 22 like related 22r dsipi gilz isoform member hdip immunore predicted kda t22d3_human 37622903 np_932174 q99576 nm_198057 q5h9s3 q5jri9 q6fih6 q8nai1 q8wvb9 q9ubn5 q9ug13 300506 antibodies apoptosis partial corresponding aa1 97 from tag mw the alone 26kd sequence maqskldcrspvgldccnccldlahrsglqrgssgennnpgsptvsnfrqlqeklvfenlntdklnsimrqdslepvlrdpcylinegicnrnidqt conjugate ph7.2 lane1 22.2kd2 family3 aa197
⇄specificity => string (25) "Recognizes human TSC22D3."
$value[16]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[16]['_source']['purity']
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value[16]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value[16]['_source']['concentration']
⇄⧉storage_stability => string (488) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[16]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[16]['_source']['app_notes']
⇄⧉testing_protocols => string (981) "WB (Western Blot)||Western Blot detection against Immunogen (36.41kD).||AAA2...
$value[16]['_source']['testing_protocols']
WB (Western Blot)||Western Blot detection against Immunogen (36.41kD).||AAA25283_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged TSC22D3 is ~0.03ng/ml as a capture antibody.||AAA25283_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of TSC22D3 transfected lysate using TSC22D3 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TSC22D3 rabbit polyclonal antibody.||AAA25283_IP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to TSC22D3 on HeLa cell. [antibody concentration 10ug/ml].||AAA25283_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to TSC22D3 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml].||AAA25283_IHC2.jpg!!WB (Western Blot)||Western Blot analysis of TSC22D3 expression in transfected 293T cell line by TSC22D3 monoclonal antibody. Lane 1: TSC22D3 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.||AAA25283_WB.jpg
⇄⧉etc_term1 => string (268) "Immunogen||Partial recombinant corresponding to aa1-97 from human TSC22D3 (N...
$value[16]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa1-97 from human TSC22D3 (NP_932174) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT!!Conjugate||FITC
⇄etc_term2 => string (3) "N/A"
$value[16]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[16]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[16]['_source']['products_weight']
⇄products_status => boolean true
$value[16]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[16]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "600"
$value[16]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[16]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[16]['_source']['language_id']
⇄products_name => string (7) "TSC22D3"
$value[16]['_source']['products_name']
⇄⧉products_name_oem => string (246) "TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zippe...
$value[16]['_source']['products_name_oem']
TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) (FITC)
⇄⧉search_terms => string (1295) "aaa25283 mouse human monoclonal igg1,k 3a5 purified by protein a affinity ch...
$value[16]['_source']['search_terms']
aaa25283 mouse human monoclonal igg1,k 3a5 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes tsc22d3 elisa eia immunofluorescence if immunohistochemistry ihc immunoprecipitation ip western blot wb 10ug ml applications are based on unconjugated antibody analysis of expression transfected 293t cell line lane 1 lysate 22.2kd 2 non aaa25283_wb immunoperoxidase to formalin fixed paraffin embedded lymph node concentration 3ug aaa25283_ihc2 hela aaa25283_if3 using and magnetic bead immunoblotted rabbit polyclonal aaa25283_ip4 testing data detection limit for recombinant gst tagged is ~0.03ng capture aaa25283_td5 against immunogen 36.41kd aaa25283_wb6 tsc22 domain family 3 glucocorticoid induced leucine zipper delta sleep inducing peptide immunoreactor dsip immunoreactive dip tsc 22 like related 22r dsipi gilz isoform member hdip immunore predicted kda t22d3_human 37622903 np_932174 q99576 nm_198057 q5h9s3 q5jri9 q6fih6 q8nai1 q8wvb9 q9ubn5 q9ug13 300506 antibodies apoptosis partial corresponding aa1 97 from tag mw the alone 26kd sequence maqskldcrspvgldccnccldlahrsglqrgssgennnpgsptvsnfrqlqeklvfenlntdklnsimrqdslepvlrdpcylinegicnrnidqt conjugate ph7.2 lane1 22.2kd2 family3 aa197
⇄specificity => string (25) "Recognizes human TSC22D3."
$value[17]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[17]['_source']['purity']
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[17]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[17]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[17]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (65) "IHC-P: 3ug/ml<br>Applications are based on unconjugated antibody."
$value[17]['_source']['app_notes']
⇄⧉testing_protocols => string (981) "WB (Western Blot)||Western Blot detection against Immunogen (36.41kD).||AAA2...
$value[17]['_source']['testing_protocols']
WB (Western Blot)||Western Blot detection against Immunogen (36.41kD).||AAA25576_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged TSC22D3 is ~0.03ng/ml as a capture antibody.||AAA25576_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of TSC22D3 transfected lysate using TSC22D3 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TSC22D3 rabbit polyclonal antibody.||AAA25576_IP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to TSC22D3 on HeLa cell. [antibody concentration 10ug/ml].||AAA25576_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to TSC22D3 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml].||AAA25576_IHC2.jpg!!WB (Western Blot)||Western Blot analysis of TSC22D3 expression in transfected 293T cell line by TSC22D3 monoclonal antibody. Lane 1: TSC22D3 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.||AAA25576_WB.jpg
⇄⧉etc_term1 => string (267) "Immunogen||Partial recombinant corresponding to aa1-97 from human TSC22D3 (N...
$value[17]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa1-97 from human TSC22D3 (NP_932174) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT!!Conjugate||HRP
⇄etc_term2 => string (3) "N/A"
$value[17]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[17]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[17]['_source']['products_weight']
⇄products_status => boolean true
$value[17]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[17]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "600"
$value[17]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[17]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[17]['_source']['language_id']
⇄products_name => string (7) "TSC22D3"
$value[17]['_source']['products_name']
⇄⧉products_name_oem => string (245) "TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zippe...
$value[17]['_source']['products_name_oem']
TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) (HRP)
⇄⧉search_terms => string (1292) "aaa25576 mouse human monoclonal igg1,k 3a5 purified by protein a affinity ch...
$value[17]['_source']['search_terms']
aaa25576 mouse human monoclonal igg1,k 3a5 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes tsc22d3 elisa eia immunohistochemistry ihc paraffin immunoprecipitation ip western blot wb p 3ug ml applications are based on unconjugated antibody analysis of expression transfected 293t cell line lane 1 lysate 22.2kd 2 non aaa25576_wb immunoperoxidase to formalin fixed embedded lymph node concentration aaa25576_ihc2 immunofluorescence if hela 10ug aaa25576_if3 using and magnetic bead immunoblotted rabbit polyclonal aaa25576_ip4 testing data detection limit for recombinant gst tagged is ~0.03ng capture aaa25576_td5 against immunogen 36.41kd aaa25576_wb6 tsc22 domain family 3 glucocorticoid induced leucine zipper delta sleep inducing peptide immunoreactor dsip immunoreactive dip tsc 22 like related 22r dsipi gilz isoform member hdip immunore predicted kda t22d3_human 37622903 np_932174 q99576 nm_198057 q5h9s3 q5jri9 q6fih6 q8nai1 q8wvb9 q9ubn5 q9ug13 300506 antibodies apoptosis partial corresponding aa1 97 from tag mw the alone 26kd sequence maqskldcrspvgldccnccldlahrsglqrgssgennnpgsptvsnfrqlqeklvfenlntdklnsimrqdslepvlrdpcylinegicnrnidqt conjugate ph7.2 lane1 22.2kd2 family3 aa197
⇄⧉products_name_syn => string (175) "Transforming growth factor beta receptor type 3; TGF-beta receptor type 3; T...
$value[18]['_source']['products_name_syn']
Transforming growth factor beta receptor type 3; TGF-beta receptor type 3; TGFR-3; Betaglycan; Transforming growth factor beta receptor III; TGF-beta receptor type III; Tgfbr3
⇄products_gene_name => string (6) "Tgfbr3"
$value[18]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[18]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1104) "Intended Uses: This immunoassay kit allows for the in vitro quantitative det...
$value[18]['_source']['products_description']
Intended Uses: This immunoassay kit allows for the in vitro quantitative determination of target antigen concentrations in serum, plasma, tissue homogenates, cell culture supernates or other biological fluids.<br><br>Principle of the Assay: The microtiter plate provided in this kit has been pre-coated with an antibody specific to target antigen. Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody preparation specific for target antigen and then avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. Then a TMB substrate solution is added to each well. Only those wells that contain target antigen, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm +/- 2 nm. The concentration of target antigen in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (422) "aaa23239 mouse recombinant and natural tgf beta receptor type 3 typical test...
$value[18]['_source']['search_terms']
aaa23239 mouse recombinant and natural tgf beta receptor type 3 typical testing data standard curve for reference only aaa23239_sc elisa kit transforming growth factor tgfr betaglycan iii tgfbr3 tbriii au015626 aw215636 1110036h20rik 93,829 da tgbr3_mouse 47271511 np_035708.2 o88393 nm_011578.3 q6ns72 assay sandwich detection range 0.156 10 ng ml sensitivity 0.085 intra cv <=4.8 inter <=7.5 recovery 89 type3 recovery89
⇄⧉specificity => string (185) "This assay has high sensitivity and excellent specificity for detection of m...
$value[19]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of mouse TGFBR3. No significant cross-reactivity or interference between mouse TGFBR3 and analogues was observed.
⇄purity => string (3) "N/A"
$value[19]['_source']['purity']
⇄form => string (3) "N/A"
$value[19]['_source']['form']
⇄concentration => string (3) "N/A"
$value[19]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[19]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[19]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (739) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[19]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for TGFBR3 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any TGFBR3 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for TGFBR3 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of TGFBR3 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Betaglycan; Transforming growth factor beta receptor III; TGF-beta receptor type III
⇄sp_gene_name => string (6) "Tgfbr3"
$value[19]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (60) "TGF-beta receptor type 3; TGFR-3; TGF-beta receptor type III"
$value[19]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (11) "TGBR3_MOUSE"
$value[19]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[19]['_source']['sp_mim']
⇄sp_interactions => string (9) "Tgfb1||81"
$value[19]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[19]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[19]['_source']['products_viewed']
⇄⧉search_terms => string (688) "aaa18225 mouse this assay has high sensitivity and excellent specificity for...
$value[19]['_source']['search_terms']
aaa18225 mouse this assay has high sensitivity and excellent specificity for detection of tgfbr3 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18225_td elisa kit transforming growth factor beta receptor iii type 3 bgcan betaglycan proteoglycan tbriii au015626 aw215636 1110036h20rik tgfr tgf 93,829 da tgbr3_mouse 47271511 np_035708.2 o88393 nm_011578.3 q6ns72 samples serum plasma tissue homogenates cell lysates quantitative sandwich range 6.25 pg ml 400 < 1.56 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in type3 ml400
