Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MELKSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Rabbit anti-Human MELK Polyclonal Antibody | anti-MELK antibody

MELK Antibody - middle region

Gene Names
MELK; HPK38
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MELK; Polyclonal Antibody; MELK Antibody - middle region; anti-MELK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVT
Sequence Length
457
Applicable Applications for anti-MELK antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human MELK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MELKSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MELKSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-MELK antibody
This is a rabbit polyclonal antibody against MELK. It was validated on Western Blot

Target Description: MELK is a serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. It acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. And it plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. It may also play a role in primitive hematopoiesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
maternal embryonic leucine zipper kinase isoform 2
NCBI Official Synonym Full Names
maternal embryonic leucine zipper kinase
NCBI Official Symbol
MELK
NCBI Official Synonym Symbols
HPK38
NCBI Protein Information
maternal embryonic leucine zipper kinase
UniProt Protein Name
Maternal embryonic leucine zipper kinase
UniProt Gene Name
MELK
UniProt Synonym Gene Names
KIAA0175; hMELK; pEg3 kinase; hPK38
UniProt Entry Name
MELK_HUMAN

Uniprot Description

MELK: Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis. Monomer. Interacts with ZNF622 and PPP1R8. Up-regulated in many cancers cells. Up-regulated upon treatment with radiation or 5-fluorouracil (5-FU) in colorectal cancer cells, suggesting that it might be associated with increased resistance of colorectal cells against radiation and 5- FU. Down-regulated upon siomycin A, a thiazole antibiotic, treatment, leading to inhibit tumor growth in vivo. Expressed in placenta, kidney, thymus, testis, ovary and intestine. Activated by autophosphorylation of the T-loop at Thr-167 and Ser-171: in contrast to other members of the SNF1 subfamily, phosphorylation at Thr-167 is not mediated by STK11/LKB1 but via autophosphorylation instead. Inhibited by calcium-binding. Kinase activity is also regulated by reducing agents: dithiothreitol (DTT) or reduced glutathione are required for kinase activity in vitro; such dependence is however not due to the presence of disulfide bonds. Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily.

Protein type: Kinase, protein; EC 2.7.10.2; EC 2.7.11.1; RNA splicing; Protein kinase, Ser/Thr (non-receptor); Protein kinase, CAMK; CAMK group; CAMKL family; MELK subfamily

Chromosomal Location of Human Ortholog: 9p13.2

Cellular Component: membrane; plasma membrane; cell cortex

Molecular Function: protein serine/threonine kinase activity; protein binding; non-membrane spanning protein tyrosine kinase activity; calcium ion binding; lipid binding; ATP binding

Biological Process: cell proliferation; peptidyl-tyrosine phosphorylation; apoptosis; positive regulation of apoptosis; protein amino acid autophosphorylation; hemopoiesis; G2/M transition of mitotic cell cycle; induction of apoptosis by oxidative stress

Research Articles on MELK

Similar Products

Product Notes

The MELK melk (Catalog #AAA3219521) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MELK Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MELK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MELK melk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEETPKRKGA KVFGSLERGL DKVITVLTRS KRKGSARDGP RRLKLHYNVT. It is sometimes possible for the material contained within the vial of "MELK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.