Western Blot (WB)
(WB Suggested Anti-Meis1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)
Rabbit Meis1 Polyclonal Antibody | anti-MEIS1 antibody
Meis1 antibody - N-terminal region
Gene Names
Meis1; Evi8; C530044H18Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Meis1; Polyclonal Antibody; Meis1 antibody - N-terminal region; anti-MEIS1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKR
Sequence Length
465
Applicable Applications for anti-MEIS1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Meis1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)
Western Blot (WB)
(WB Suggested Anti-Meis1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)
Related Product Information for anti-MEIS1 antibody
This is a rabbit polyclonal antibody against Meis1. It was validated on Western Blot
Target Description: Meis1 acts as a transcriptional regulator of PAX6 and a transcriptional activator of PF4 in complex with PBX1 or PBX2. It is required for hematopoiesis, megakaryocyte lineage development and vascular patterning. It may function as a cofactor for HOXA7 and HOXA9 in the induction of myeloid leukemias.
Target Description: Meis1 acts as a transcriptional regulator of PAX6 and a transcriptional activator of PF4 in complex with PBX1 or PBX2. It is required for hematopoiesis, megakaryocyte lineage development and vascular patterning. It may function as a cofactor for HOXA7 and HOXA9 in the induction of myeloid leukemias.
Product Categories/Family for anti-MEIS1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
homeobox protein Meis1 isoform A
NCBI Official Synonym Full Names
Meis homeobox 1
NCBI Official Symbol
Meis1
NCBI Official Synonym Symbols
Evi8; C530044H18Rik
NCBI Protein Information
homeobox protein Meis1
UniProt Protein Name
Homeobox protein Meis1
Protein Family
UniProt Gene Name
Meis1
UniProt Entry Name
MEIS1_MOUSE
Research Articles on MEIS1
1. found miR-155 to be a direct target of Meis1 in murine Hoxa9/Meis1 induced acute myeloid leukemia.
Similar Products
Product Notes
The MEIS1 meis1 (Catalog #AAA3203926) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Meis1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Meis1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MEIS1 meis1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YGDPHAARSM QPVHHLNHGP PLHSHQYPHT AHTNAMAPSM GSSVNDALKR. It is sometimes possible for the material contained within the vial of "Meis1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
