Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of mouse heart, using MEF2B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Rabbit anti-Mouse MEF2B Polyclonal Antibody | anti-MEF2B antibody

MEF2B Rabbit pAb

Gene Names
MEF2B; RSRFR2
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
MEF2B; Polyclonal Antibody; MEF2B Rabbit pAb; RSRFR2; anti-MEF2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYASTDMDRVLLKYTEYSEPHESRTNTDILETLKRRGIGLDGPEL
Applicable Applications for anti-MEF2B antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEF2B (NP_005910.1).
Cellular Location
Nucleus
Positive Samples
Mouse heart
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of mouse heart, using MEF2B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Western Blot (WB) (Western blot analysis of extracts of mouse heart, using MEF2B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-MEF2B antibody
Background: The product of this gene is a member of the MADS/MEF2 family of DNA binding proteins. The protein is thought to regulate gene expression, including expression of the smooth muscle myosin heavy chain gene. This region undergoes considerable alternative splicing, with transcripts supporting two non-overlapping loci (GeneID 729991 and 100271849) as well as numerous read-through transcripts that span both loci (annotated as GeneID 4207). Several isoforms of this protein are expressed from either this locus or from some of the read-through transcripts annotated on GeneID 4207.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,639 Da
NCBI Official Full Name
myocyte-specific enhancer factor 2B isoform a
NCBI Official Synonym Full Names
myocyte enhancer factor 2B
NCBI Official Symbol
MEF2B
NCBI Official Synonym Symbols
RSRFR2
NCBI Protein Information
myocyte-specific enhancer factor 2B; serum response factor-like protein 2; MADS box transcription enhancer factor 2, polypeptide B (myocyte enhancer factor 2B)
UniProt Protein Name
Myocyte-specific enhancer factor 2B
UniProt Gene Name
MEF2B
UniProt Synonym Gene Names
XMEF2
UniProt Entry Name
MEF2B_HUMAN

NCBI Description

The product of this gene is a member of the MADS/MEF2 family of DNA binding proteins. The protein is thought to regulate gene expression, including expression of the smooth muscle myosin heavy chain gene. This region undergoes considerable alternative splicing, with transcripts supporting two non-overlapping loci (geneID:729991 and 100271849) as well as numerous read-through transcripts that span both loci (annotated as geneID:4207). Several isoforms of this protein are expressed from either this locus or from some of the read-through transcripts annotated on geneID:4207. [provided by RefSeq, Mar 2009]

Uniprot Description

MEF2B: Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle- specific genes. Activates transcription via this element. May be involved in muscle-specific and/or growth factor-related transcription. Belongs to the MEF2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; cell junction; nucleus

Molecular Function: protein dimerization activity; histone deacetylase binding; transcription factor activity

Biological Process: muscle development; transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter

Research Articles on MEF2B

Similar Products

Product Notes

The MEF2B mef2b (Catalog #AAA9142137) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MEF2B Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MEF2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the MEF2B mef2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGRKKIQISR ILDQRNRQVT FTKRKFGLMK KAYELSVLCD CEIALIIFNS ANRLFQYAST DMDRVLLKYT EYSEPHESRT NTDILETLKR RGIGLDGPEL. It is sometimes possible for the material contained within the vial of "MEF2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.