Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit MBOAT1 Polyclonal Antibody | anti-MBOAT1 antibody

MBOAT1 antibody

Gene Names
Mboat1; Oact1; LPEAT1; Moact1; BC023845; 9130215M02Rik
Applications
Western Blot
Purity
Affinity purified
Synonyms
MBOAT1; Polyclonal Antibody; MBOAT1 antibody; Polyclonal MBOAT1; Anti-MBOAT1; MBOAT 1; MBOAT-1; dJ434O11.1; MGC44669; Membrane Bound O-Acyltransferase Domain Containing 1; OACT1; anti-MBOAT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
MBOAT1 antibody was raised against the N terminal of MBOAT1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MBOAT1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
492
Applicable Applications for anti-MBOAT1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets.
Cross-Reactivity
Human
Immunogen
MBOAT1 antibody was raised using the N terminal of MBOAT1 corresponding to a region with amino acids AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-MBOAT1 antibody
Rabbit polyclonal MBOAT1 antibody raised against the N terminal of MBOAT1
Product Categories/Family for anti-MBOAT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
56 kDa (MW of target protein)
NCBI Official Full Name
Mboat1 protein
NCBI Official Synonym Full Names
membrane bound O-acyltransferase domain containing 1
NCBI Official Symbol
Mboat1
NCBI Official Synonym Symbols
Oact1; LPEAT1; Moact1; BC023845; 9130215M02Rik
NCBI Protein Information
lysophospholipid acyltransferase 1
UniProt Protein Name
Lysophospholipid acyltransferase 1
UniProt Gene Name
Mboat1
UniProt Synonym Gene Names
Lpeat1; Oact1; LPLAT 1; LPEAT; Lyso-PE acyltransferase; LPSAT; Lyso-PS acyltransferase; O-acyltransferase domain-containing protein 1
UniProt Entry Name
MBOA1_MOUSE

Uniprot Description

MBOAT1: Acyltransferase which mediates the conversion of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L- serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3- phospho-L-serine or PS) (LPSAT activity). Prefers oleoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle. Belongs to the membrane-bound acyltransferase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; EC 2.3.1.n6; Transferase

Cellular Component: membrane; endoplasmic reticulum; integral to membrane

Molecular Function: keto acid formate lyase activity; glucosaminyl-phosphotidylinositol O-acyltransferase activity; S-malonyltransferase activity; 3-hydroxybutyryl-CoA thiolase activity; S-acetyltransferase activity; O-octanoyltransferase activity; O-sinapoyltransferase activity; acyl-CoA N-acyltransferase activity; palmitoleoyl [acyl-carrier-protein]-dependent acyltransferase activity; peptidyl-lysine N6-myristoyltransferase activity; peptidyl-lysine N6-palmitoyltransferase activity; azetidine-2-carboxylic acid acetyltransferase activity; dihydrolipoamide branched chain acyltransferase activity; succinyltransferase activity; Ras palmitoyltransferase activity; palmitoyltransferase activity; C-acyltransferase activity; C-palmitoyltransferase activity; dihydrolipoamide S-acyltransferase activity; protein-cysteine S-acyltransferase activity; N-acetyltransferase activity; serine O-acyltransferase activity; O-palmitoyltransferase activity; octanoyltransferase activity; malonyltransferase activity; O-succinyltransferase activity; carnitine O-acyltransferase activity; 3-ketopimelyl-CoA thiolase activity; sterol O-acyltransferase activity; S-succinyltransferase activity; N-acyltransferase activity; UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase activity; O-acyltransferase activity; N-palmitoyltransferase activity; acylglycerol O-acyltransferase activity; O-acetyltransferase activity; transferase activity; benzoyl acetate-CoA thiolase activity; sinapoyltransferase activity; protein-cysteine S-myristoyltransferase activity; S-acyltransferase activity; N-succinyltransferase activity; myristoyltransferase activity; acetyltransferase activity; transferase activity, transferring acyl groups; L-2-aminoadipate N-acetyltransferase activity

Biological Process: lipid metabolic process; phospholipid biosynthetic process

Similar Products

Product Notes

The MBOAT1 mboat1 (Catalog #AAA5302815) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MBOAT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the MBOAT1 mboat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MBOAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.