Western Blot (WB)
(Figure 1. Western blot analysis of MATH1/HATH1 using anti-MATH1/HATH1 antibody (MBS1750755).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysate,Lane 2: mouse brain tissue lysate
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MATH1/HATH1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MATH1/HATH1 at approximately 38KD. The expected band size for MATH1/HATH1 is at 38KD. )
Rabbit MATH1/HATH1 Polyclonal Antibody | anti-MATH1/HATH1 antibody
Anti-MATH1/HATH1 Picoband Antibody
Gene Names
ATOH1; ATH1; HATH1; MATH-1; bHLHa14
Reactivity
Human, Mouse, RatNo cross reactivity with other proteins.
Applications
Western Blot
Purity
Immunogen affinity purified
Synonyms
MATH1/HATH1; Polyclonal Antibody; Anti-MATH1/HATH1 Picoband Antibody; Protein atonal homolog 1; Class A basic helix-loop-helix protein 14; bHLHa14; Helix-loop-helix protein hATH-1; hATH1; ATOH1; ATH1; BHLHA14; anti-MATH1/HATH1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
No cross reactivity with other proteins.
Clonality
Polyclonal
Purity/Purification
Immunogen affinity purified
Form/Format
Lyophilized
Concentration
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. (varies by lot)
Sequence Length
354
Applicable Applications for anti-MATH1/HATH1 antibody
Western Blot (WB)
Application Notes
WB: 0.1-0.5mug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human MATH1/HATH1 (1-30aa MSRLLHAEEWAEVKELGDHHRQPQPHHLPQ), different from the related mouse sequence by three amino acids.
Subcellular Localization
Nucleus.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Figure 1. Western blot analysis of MATH1/HATH1 using anti-MATH1/HATH1 antibody (MBS1750755). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat brain tissue lysate,Lane 2: mouse brain tissue lysate After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MATH1/HATH1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MATH1/HATH1 at approximately 38KD. The expected band size for MATH1/HATH1 is at 38KD. )
Western Blot (WB)
(Figure 1. Western blot analysis of MATH1/HATH1 using anti-MATH1/HATH1 antibody (MBS1750755).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysate,Lane 2: mouse brain tissue lysate
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MATH1/HATH1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MATH1/HATH1 at approximately 38KD. The expected band size for MATH1/HATH1 is at 38KD. )
Related Product Information for anti-MATH1/HATH1 antibody
Description: Protein atonal homolog 1 is a protein that in humans is encoded by the ATOH1 gene. This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. ATOH1 is required for the formation of both neural and non-neural cell types. Using genetic deletion in mice, Atoh1 has been shown to be essential for formation of cerebellar granule neurons, inner ear hair cells, spinal cord interneurons, Merkel cells of the skin, and intestinal secretory cells (goblet, enteroendocrine, and Paneth cells).
Protein Function: Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription (By similarity).
Protein Function: Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription (By similarity).
Product Categories/Family for anti-MATH1/HATH1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38160 MW
NCBI Official Full Name
protein atonal homolog 1
NCBI Official Synonym Full Names
atonal bHLH transcription factor 1
NCBI Official Symbol
ATOH1
NCBI Official Synonym Symbols
ATH1; HATH1; MATH-1; bHLHa14
NCBI Protein Information
protein atonal homolog 1
UniProt Protein Name
Protein atonal homolog 1
UniProt Gene Name
ATOH1
UniProt Synonym Gene Names
ATH1; BHLHA14; bHLHa14; hATH1
NCBI Description
This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. [provided by RefSeq, Jul 2008]
Uniprot Description
Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription ().
Research Articles on MATH1/HATH1
Similar Products
Product Notes
The MATH1/HATH1 atoh1 (Catalog #AAA1750755) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-MATH1/HATH1 Picoband Antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's MATH1/HATH1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.1-0.5mug/ml. Researchers should empirically determine the suitability of the MATH1/HATH1 atoh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MATH1/HATH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
