Western Blot (WB)
(Western blot analysis of extracts of HepG2 cells, using MAS1L antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
Rabbit anti-Human MAS1L Polyclonal Antibody | anti-MAS1L antibody
MAS1L Rabbit pAb
Gene Names
MAS1L; MRG; MAS-L; dJ994E9.2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
MAS1L; Polyclonal Antibody; MAS1L Rabbit pAb; MAS-L; MRG; dJ994E9.2; anti-MAS1L antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MVWGKICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQ
Applicable Applications for anti-MAS1L antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MAS1L (NP_443199.1).
Cellular Location
Cell membrane, Multi-pass membrane protein
Positive Samples
HepG2
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of HepG2 cells, using MAS1L antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
Western Blot (WB)
(Western blot analysis of extracts of HepG2 cells, using MAS1L antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
Product Categories/Family for anti-MAS1L antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,411 Da
NCBI Official Full Name
mas-related G-protein coupled receptor MRG
NCBI Official Synonym Full Names
MAS1 proto-oncogene like, G protein-coupled receptor
NCBI Official Symbol
MAS1L
NCBI Official Synonym Symbols
MRG; MAS-L; dJ994E9.2
NCBI Protein Information
mas-related G-protein coupled receptor MRG; MAS-R; MAS1-like; MAS1 oncogene-like; mas-related G protein-coupled MRG
UniProt Protein Name
Mas-related G-protein coupled receptor MRG
Protein Family
UniProt Gene Name
MAS1L
UniProt Synonym Gene Names
MRG; MAS-R
UniProt Entry Name
MAS1L_HUMAN
Uniprot Description
MAS1L: Belongs to the G-protein coupled receptor 1 family. Mas subfamily.
Protein type: Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1; Receptor, GPCR
Chromosomal Location of Human Ortholog: 6p22.1
Cellular Component: nucleoplasm; cytoplasm; integral to membrane; plasma membrane
Molecular Function: G-protein coupled receptor activity
Biological Process: G-protein coupled receptor protein signaling pathway
Research Articles on MAS1L
Similar Products
Product Notes
The MAS1L mas1l (Catalog #AAA9142199) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAS1L Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAS1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the MAS1L mas1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVWGKICWFS QRAGWTVFAE SQISLSCSLC LHSGDQEAQN PNLVSQLCGV FLQNETNETI HMQMSMAVGQ. It is sometimes possible for the material contained within the vial of "MAS1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
