Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MARK2Sample Tissue: Human HCT15 Whole CellAntibody Dilution: 1ug/ml)

Rabbit anti-Human MARK2 Polyclonal Antibody | anti-MARK2 antibody

MARK2 Antibody - C-terminal region

Gene Names
MARK2; EMK1; EMK-1; PAR-1; Par1b; Par-1b
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MARK2; Polyclonal Antibody; MARK2 Antibody - C-terminal region; anti-MARK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKT
Sequence Length
788
Applicable Applications for anti-MARK2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MARK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MARK2Sample Tissue: Human HCT15 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MARK2Sample Tissue: Human HCT15 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-MARK2 antibody
This is a rabbit polyclonal antibody against MARK2. It was validated on Western Blot

Target Description: This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inactivation of several microtubule-associating proteins. The protein localizes to cell membranes. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-MARK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
serine/threonine-protein kinase MARK2 isoform d
NCBI Official Synonym Full Names
microtubule affinity regulating kinase 2
NCBI Official Symbol
MARK2
NCBI Official Synonym Symbols
EMK1; EMK-1; PAR-1; Par1b; Par-1b
NCBI Protein Information
serine/threonine-protein kinase MARK2
UniProt Protein Name
Serine/threonine-protein kinase MARK2
UniProt Gene Name
MARK2
UniProt Synonym Gene Names
EMK1; EMK-1; Par-1b; Par1b
UniProt Entry Name
MARK2_HUMAN

NCBI Description

This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inactivation of several microtubule-associating proteins. The protein localizes to cell membranes. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2009]

Uniprot Description

MARK2: a CAMK protein kinase of the CAMKL group. Plays a role in epithelial morphogenesis. Modulates the developmental decision to build a columnar versus a hepatic epithelial cell apparently by promoting a switch from a direct to a transcytotic mode of apical protein delivery. Essential for the asymmetric development of membrane domains of polarized epithelial cells. One or more isoforms may play a role in graft rejection. 12 isoforms of the human protein are produced by alternative promoter.

Protein type: EC 2.7.11.26; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Protein kinase, CAMK; EC 2.7.11.1; CAMK group; CAMKL family; MARK subfamily

Chromosomal Location of Human Ortholog: 11q13.1

Cellular Component: mitochondrion; membrane; plasma membrane; actin filament; basal cortex; nucleus; lateral plasma membrane

Molecular Function: protein serine/threonine kinase activity; protein binding; tau-protein kinase activity; magnesium ion binding; protein kinase activator activity; lipid binding; ATP binding

Biological Process: establishment and/or maintenance of epithelial cell polarity; Wnt receptor signaling pathway; establishment of cell polarity; protein amino acid autophosphorylation; mitochondrion degradation; activation of protein kinase activity; peptidyl-threonine phosphorylation; neuron migration; mitochondrion localization; regulation of axonogenesis; protein amino acid phosphorylation; regulation of cytoskeleton organization and biogenesis

Research Articles on MARK2

Similar Products

Product Notes

The MARK2 mark2 (Catalog #AAA3219517) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MARK2 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MARK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MARK2 mark2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IPTSNSYSKK TQSNNAENKR PEEDRESGRK ASSTAKVPAS PLPGLERKKT. It is sometimes possible for the material contained within the vial of "MARK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.