Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-MAPK3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Ovary TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit MAPK3 Polyclonal Antibody | anti-MAPK3 antibody

MAPK3 antibody - middle region

Gene Names
MAPK3; ERK1; ERT2; ERK-1; PRKM3; P44ERK1; P44MAPK; HS44KDAP; HUMKER1A; p44-ERK1; p44-MAPK
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MAPK3; Polyclonal Antibody; MAPK3 antibody - middle region; anti-MAPK3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
Sequence Length
379
Applicable Applications for anti-MAPK3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MAPK3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-MAPK3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Ovary TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-MAPK3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Ovary TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: MouseTarget Name: MAPK3Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: MAPK3Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-MAPK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-MAPK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Related Product Information for anti-MAPK3 antibody
This is a rabbit polyclonal antibody against MAPK3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, a

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
mitogen-activated protein kinase 3 isoform 2
NCBI Official Synonym Full Names
mitogen-activated protein kinase 3
NCBI Official Symbol
MAPK3
NCBI Official Synonym Symbols
ERK1; ERT2; ERK-1; PRKM3; P44ERK1; P44MAPK; HS44KDAP; HUMKER1A; p44-ERK1; p44-MAPK
NCBI Protein Information
mitogen-activated protein kinase 3
UniProt Protein Name
Mitogen-activated protein kinase 3
UniProt Gene Name
MAPK3
UniProt Synonym Gene Names
ERK1; PRKM3; MAP kinase 3; MAPK 3; ERK-1; p44-MAPK
UniProt Entry Name
MK03_HUMAN

NCBI Description

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

ERK1: a serine/threonine kinase of the GMGC group that plays a critical role in the regulation of cell growth and differentiation. ERK1 (MAPK3) and ERK2 (MAPK1) play central roles in MAPK cascades and are activated by a wide variety of extracellular signals including growth and neurotrophic factors, cytokines, hormones and neurotransmitters. Depending on the cellular context, MAPK cascades mediate diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. MAPK cascades also plays a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. Activation of MAP kinases occurs through phosphorylation of threonine and tyrosine residues at the sequence T*EY* by upstream MAP kinase kinases, MEK1 and -2. Phosphorylation of both the threonine and tyrosine are required for activity. This phosphorylation causes dramatic conformational changes, which enable full activation and interaction of MAPK1/ERK2 with its substrates.

Protein type: Protein kinase, CMGC; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.24; Kinase, protein; CMGC group; MAPK family; ERK subfamily; MAPK/ERK subfamily

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: Golgi apparatus; focal adhesion; mitochondrion; early endosome; nuclear envelope; pseudopodium; caveola; cytosol; nucleoplasm; microtubule cytoskeleton; cytoskeleton; late endosome; nucleus

Molecular Function: MAP kinase activity; protein binding; phosphotyrosine binding; ATP binding; phosphatase binding

Biological Process: axon guidance; viral reproduction; nerve growth factor receptor signaling pathway; positive regulation of histone phosphorylation; DNA damage induced protein phosphorylation; activation of MAPKK activity; apoptosis; activation of MAPK activity; stress-activated MAPK cascade; toll-like receptor 3 signaling pathway; sensory perception of pain; protein amino acid phosphorylation; toll-like receptor 10 signaling pathway; BMP signaling pathway; toll-like receptor 5 signaling pathway; response to exogenous dsRNA; regulation of transcription factor activity; small GTPase mediated signal transduction; lipopolysaccharide-mediated signaling pathway; toll-like receptor 4 signaling pathway; epidermal growth factor receptor signaling pathway; platelet activation; fibroblast growth factor receptor signaling pathway; MyD88-independent toll-like receptor signaling pathway; cytokine and chemokine mediated signaling pathway; MAPKKK cascade; transcription from RNA polymerase I promoter; cell cycle; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; regulation of stress-activated MAPK cascade; organ morphogenesis; cartilage development; Ras protein signal transduction; toll-like receptor signaling pathway; insulin receptor signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of histone acetylation; gene expression; positive regulation of protein amino acid phosphorylation; toll-like receptor 9 signaling pathway; vascular endothelial growth factor receptor signaling pathway; blood coagulation; transcription initiation from RNA polymerase I promoter; phosphorylation; regulation of cytoskeleton organization and biogenesis

Research Articles on MAPK3

Similar Products

Product Notes

The MAPK3 mapk3 (Catalog #AAA3212766) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPK3 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAPK3 mapk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LDQLNHILGI LGSPSQEDLN CIINMKARNY LQSLPSKTKV AWAKLFPKSD. It is sometimes possible for the material contained within the vial of "MAPK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.