Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MK11Sample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit MAPK11 Polyclonal Antibody | anti-MAPK11 antibody

MAPK11 Antibody - N-terminal region

Gene Names
MAPK11; P38B; SAPK2; p38-2; PRKM11; SAPK2B; p38Beta; P38BETA2
Reactivity
Cow, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MAPK11; Polyclonal Antibody; MAPK11 Antibody - N-terminal region; anti-MAPK11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKV
Sequence Length
364
Applicable Applications for anti-MAPK11 antibody
Western Blot (WB)
Homology
Cow: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MK11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MK11Sample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MK11Sample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MAPK11 antibody
This is a rabbit polyclonal antibody against MK11. It was validated on Western Blot

Target Description: This gene encodes a member of a family of protein kinases that are involved in the integration of biochemical signals for a wide variety of cellular processes, including cell proliferation, differentiation, transcriptional regulation, and development. The encoded protein can be activated by proinflammatory cytokines and environmental stresses through phosphorylation by mitogen activated protein kinase kinases (MKKs). Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
mitogen-activated protein kinase 11
NCBI Official Synonym Full Names
mitogen-activated protein kinase 11
NCBI Official Symbol
MAPK11
NCBI Official Synonym Symbols
P38B; SAPK2; p38-2; PRKM11; SAPK2B; p38Beta; P38BETA2
NCBI Protein Information
mitogen-activated protein kinase 11
UniProt Protein Name
Mitogen-activated protein kinase 11
UniProt Gene Name
MAPK11
UniProt Synonym Gene Names
PRKM11; SAPK2; SAPK2B; MAP kinase 11; MAPK 11; MAP kinase p38 beta; p38b; SAPK2b
UniProt Entry Name
MK11_HUMAN

NCBI Description

This gene encodes a member of a family of protein kinases that are involved in the integration of biochemical signals for a wide variety of cellular processes, including cell proliferation, differentiation, transcriptional regulation, and development. The encoded protein can be activated by proinflammatory cytokines and environmental stresses through phosphorylation by mitogen activated protein kinase kinases (MKKs). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]

Uniprot Description

P38B: a proline-directed ser/thr MAP kinase, and one of four p38 kinases that play important roles in cellular responses to inflammatory cytokines, DNA damage, oxidative stress, and some GPCRs, leading to direct activation of transcription factors and of other downstream kinases including MSK1, MSK2, eEF2K, MK2, and PRAK. MSK1 and -2 play important roles in the rapid induction of immediate-early genes in response to stress or mitogenic stimuli. MK2 and -3 control gene expression mostly at the post-transcriptional level. eEF2K is important for the elongation of mRNA during translation. Ectodomain shedding of transmembrane proteins is regulated by p38 MAPKs as well. In response to inflammatory stimuli, p38 MAPKs phosphorylate the membrane-associated metalloprotease ADAM17, which then cleaves the ectodomain of TGF-alpha family ligands, a process leading to the activation of EGFR signaling and cell proliferation. In the nucleus, many transcription factors are phosphorylated and activated by p38 MAPKs in response to different stimuli. Classical examples include ATF1, ATF2, ATF6, ELK1, PTPRH, CHOPO, p53 and MEF2C and MEF2A. The p38 MAPKs are emerging as important modulators of gene expression by regulating chromatin modifiers and remodelers. The promoters of several genes involved in the inflammatory response, such as IL6, IL8 and IL12B, display a p38 MAPK-dependent enrichment of histone H3 phosphorylation on 'Ser-10' (H3S10ph) in LPS-stimulated myeloid cells. Interacts directly with HDAC3 interacts directly and selectively to repress ATF2 transcriptional activity, and regulate TNF gene expression in LPS-stimulated cells. Inhibited by SB203580 and pyridinyl-imidazole related compounds.

Protein type: Protein kinase, CMGC; EC 2.7.11.24; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); CMGC group; MAPK family; p38 subfamily; MAPK/p38 subfamily

Chromosomal Location of Human Ortholog: 22q13.33

Cellular Component: nucleoplasm; cytosol

Molecular Function: MAP kinase activity; protein serine/threonine kinase activity; protein binding; ATP binding

Biological Process: mitochondrion organization and biogenesis; nerve growth factor receptor signaling pathway; transcription, DNA-dependent; activation of MAPK activity; organelle organization and biogenesis; MyD88-independent toll-like receptor signaling pathway; stress-activated MAPK cascade; toll-like receptor 3 signaling pathway; signal transduction; protein amino acid phosphorylation; toll-like receptor 2 signaling pathway; toll-like receptor 10 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; toll-like receptor 5 signaling pathway; muscle cell differentiation; regulation of transcription factor activity; Ras protein signal transduction; toll-like receptor signaling pathway; response to stress; positive regulation of muscle cell differentiation; innate immune response; gene expression; toll-like receptor 9 signaling pathway; vascular endothelial growth factor receptor signaling pathway; toll-like receptor 4 signaling pathway

Research Articles on MAPK11

Similar Products

Product Notes

The MAPK11 mapk11 (Catalog #AAA3212771) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPK11 Antibody - N-terminal region reacts with Cow, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAPK11 mapk11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSGPRAGFYR QELNKTVWEV PQRLQGLRPV GSGAYGSVCS AYDARLRQKV. It is sometimes possible for the material contained within the vial of "MAPK11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.