MAOB Polyclonal Antibody | anti-MAOB antibody

Anti-MAOB Antibody

Cat. Num. AAA177795

• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: MAOB; Polyclonal Antibody; Anti-MAOB Antibody; Amine oxidase [flavin-containing] B; Adrenalin oxidase; Amine oxidase (flavin containing); AOFB_HUMAN; HGNC:6834; MAO; brain; platelet; MAO-B; MGC26382; Monoamine oxidase B; Monoamine oxidase type B; OTTHUMP00000023166; RP1 201D17__B.1; Tyramine oxidase antibody; monoamine oxidase B; anti-MAOB antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 520

• Applicable Applications for anti-MAOB antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MAOB (448-484aa REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- MAOB Picoband antibody, MBS177795, Western blottingAll lanes: Anti MAOB (MBS177795) at 0.5ug/mlLane 1: Rat Cardiac MuscleTissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Rat Intestine Tissue Lysate at 50ugLane 4: Mouse Kidney Tissue Lysate at 50ugLane 5: Mouse Intestine Tissue Lysate at 50ugLane 6: Mouse Cardiac Muscle Tissue Lysate at 50ugLane 7: HEPG2 Whole Cell Lysate at 40ugLane 8: HELA Whole Cell Lysate at 40ugLane 9: COLO320 Whole Cell Lysate at 40ugPredicted bind size: 59KDObserved bind size: 59KD )

Immunohistochemistry (IHC)

(Anti- MAOB Picoband antibody, MBS177795,IHC(P)IHC(P): Mouse Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- MAOB Picoband antibody, MBS177795,IHC(P)IHC(P): Rat Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- MAOB Picoband antibody, MBS177795,IHC(P)IHC(P): Human Lung Cancer Tissue )

Western Blot (WB)

(Anti- MAOB Picoband antibody, MBS177795, Western blottingAll lanes: Anti MAOB (MBS177795) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugPredicted bind size: 59KDObserved bind size: 59KD )

Related Product Information for anti-MAOB antibody

Description: Rabbit IgG polyclonal antibody for Amine oxidase [flavin-containing] B(MAOB) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: MAOB (MONOAMINE OXIDASE B), also called MAO, BRAIN, AMINE OXIDASE (FLAVIN-CONTAINING) B, is a protein that in humans is encoded by the MAOB gene. MAOB is a member of the flavin monoamine oxidase family. And it is mapped on Xp11.3. MAOB catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine. Like MAOA, it also degrades dopamine. MAO-B is involved in the breakdown of dopamine, a neurotransmitter implicated in reinforcing and motivating behaviors as well as movement. MAO-B inhibition is, therefore, associated with enhanced activity of dopamine, as well as with decreased production of hydrogen peroxide, a source of reactive oxygen species.

References

1. Bach, A. W., Lan, N. C., Johnson, D. L., Abell, C. W., Bembenek, M. E., Kwan, S.-W., Seeburg, P. H., Shih, J. C. cDNA cloning of human liver monoamine oxidase A and B: molecular basis of differences in enzymatic properties. Proc. Nat. Acad. Sci. 85: 4934-4938, 1988. 2. Binda, C., Newton-Vinson, P., Hubalek, F., Edmondson, D. E., Mattevi, A. Structure of human monoamine oxidase B, a drug target for the treatment of neurological disorders. Nature Struct. Biol. 9: 22-26, 2002. 3. Edmondson DE, Binda C, Mattevi A (2007). "STRUCTURAL INSIGHTS INTO THE MECHANISM OF AMINE OXIDATION BY MONOAMINE OXIDASES A AND B". Archives of Biochemistry and Biophysics 464 (2): 269-76.

NCBI and Uniprot Product Information

• NCBI GI #: 38202207
• NCBI GeneID: 4129
• NCBI Accession #: NP_000889.3
• NCBI GenBank Nucleotide #: NM_000898.4
• UniProt Accession #: P27338; Q7Z6S2; B2R6R3; B7Z5H3; D3DWC3
• Molecular Weight: 46,539 Da
• NCBI Official Full Name: amine oxidase
• NCBI Official Synonym Full Names: monoamine oxidase B
• NCBI Official Symbol: MAOB
• NCBI Protein Information: amine oxidase [flavin-containing] B
• UniProt Protein Name: Amine oxidase [flavin-containing] B
• Protein Family: Amine oxidase
• UniProt Gene Name: MAOB
• UniProt Synonym Gene Names: MAO-B
• UniProt Entry Name: AOFB_HUMAN

NCBI Description

The protein encoded by this gene belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine. [provided by RefSeq, Jul 2008]

Uniprot Description

MAOB: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOB preferentially degrades benzylamine and phenylethylamine. Belongs to the flavin monoamine oxidase family.

Protein type: Amino Acid Metabolism - histidine; Amino Acid Metabolism - arginine and proline; Amino Acid Metabolism - tryptophan; Oxidoreductase; Amino Acid Metabolism - tyrosine; EC 1.4.3.4; Membrane protein, integral; Amino Acid Metabolism - phenylalanine; Mitochondrial; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Amino Acid Metabolism - glycine, serine and threonine

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: integral to membrane; mitochondrial envelope; mitochondrial inner membrane; mitochondrial outer membrane; mitochondrion

Molecular Function: amine oxidase activity; electron carrier activity; FAD binding; protein homodimerization activity

Biological Process: dopamine catabolic process; hydrogen peroxide biosynthetic process; negative regulation of serotonin secretion; positive regulation of dopamine metabolic process; response to aluminum ion; response to corticosterone stimulus; response to drug; response to ethanol; response to lipopolysaccharide; response to selenium ion; response to toxin; substantia nigra development