Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MALT1Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MALT1 Polyclonal Antibody | anti-MALT1 antibody

MALT1 Antibody - middle region

Gene Names
MALT1; MLT; MLT1; IMD12; PCASP1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MALT1; Polyclonal Antibody; MALT1 Antibody - middle region; anti-MALT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YWCHVYNDRDSQDSKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQ
Sequence Length
824
Applicable Applications for anti-MALT1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human MALT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MALT1Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MALT1Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MALT1 antibody
This is a rabbit polyclonal antibody against MALT1. It was validated on Western Blot

Target Description: This gene has been found to be recurrently rearranged in chromosomal translocation with two other genes - baculoviral IAP repeat-containing protein 3 (also known as apoptosis inhibitor 2) and immunoglobulin heavy chain locus - in mucosa-associated lymphoid tissue lymphomas. The protein encoded by this gene may play a role in NF-kappaB activation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for anti-MALT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
mucosa-associated lymphoid tissue lymphoma translocation protein 1 isoform a
NCBI Official Synonym Full Names
MALT1 paracaspase
NCBI Official Symbol
MALT1
NCBI Official Synonym Symbols
MLT; MLT1; IMD12; PCASP1
NCBI Protein Information
mucosa-associated lymphoid tissue lymphoma translocation protein 1
UniProt Protein Name
Mucosa-associated lymphoid tissue lymphoma translocation protein 1
UniProt Gene Name
MALT1
UniProt Synonym Gene Names
MLT
UniProt Entry Name
MALT1_HUMAN

NCBI Description

This gene encodes a caspase-like protease that plays a role in BCL10-induced activation of NF-kappaB. The protein is a component of the CARMA1-BCL10-MALT1 (CBM) signalosome that triggers NF-kappaB signaling and lymphoctye activation following antigen-receptor stimulation. Mutations in this gene result in immunodeficiency 12 (IMD12). This gene has been found to be recurrently rearranged in chromosomal translocations with other genes in mucosa-associated lymphoid tissue lymphomas, including a t(11;18)(q21;q21) translocation with the baculoviral IAP repeat-containing protein 3 (also known as apoptosis inhibitor 2) locus [BIRC3(API2)-MALT1], and a t(14;18)(q32;q21) translocation with the immunoglobulin heavy chain locus (IGH-MALT1). Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2018]

Uniprot Description

MALT1: Enhances BCL10-induced activation of NF-kappa-B. Involved in nuclear export of BCL10. Binds to TRAF6, inducing TRAF6 oligomerization and activation of its ligase activity. Has ubiquitin ligase activity. MALT1-dependent BCL10 cleavage plays an important role in T-cell antigen receptor-induced integrin adhesion. Binds through its Ig-like domains to BCL10. Forms oligomers which bind to TRAF6. Highly expressed in peripheral blood mononuclear cells. Detected at lower levels in bone marrow, thymus and lymph node, and at very low levels in colon and lung. Belongs to the peptidase C14B family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear export; Ligase; Adaptor/scaffold; EC 3.4.22.-; Protease; Ubiquitin conjugating system; Apoptosis

Chromosomal Location of Human Ortholog: 18q21

Cellular Component: CBM complex; protein complex; perinuclear region of cytoplasm; cytoplasm; plasma membrane; nucleolus; nucleus; cytosol

Molecular Function: peptidase activity; protein binding; signal transducer activity; protein self-association; protease binding; cysteine-type endopeptidase activity; ubiquitin-protein ligase activity; kinase activator activity

Biological Process: response to fungus; positive regulation of I-kappaB kinase/NF-kappaB cascade; nuclear export; activation of NF-kappaB-inducing kinase; positive regulation of T cell cytokine production; protein ubiquitination; defense response; proteolysis; T cell receptor signaling pathway; protein oligomerization; activation of NF-kappaB transcription factor; T cell proliferation; regulation of apoptosis; B-1 B cell differentiation; positive regulation of protein ubiquitination; response to molecule of bacterial origin; regulation of T cell receptor signaling pathway; positive regulation of interleukin-2 production; innate immune response; positive regulation of T cell activation; negative regulation of apoptosis

Disease: Immunodeficiency 12

Research Articles on MALT1

Similar Products

Product Notes

The MALT1 malt1 (Catalog #AAA3219189) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MALT1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MALT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MALT1 malt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YWCHVYNDRD SQDSKKVEII IGRTDEAVEC TEDELNNLGH PDNKEQTTDQ. It is sometimes possible for the material contained within the vial of "MALT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.