Rabbit MAK Polyclonal Antibody | anti-MAK antibody

MAK Rabbit pAb

Cat. Num. AAA9142805

• Gene Names: MAK; RP62; dJ417M14.2
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity purification
• Synonyms: MAK; Polyclonal Antibody; MAK Rabbit pAb; RP62; anti-MAK antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Sequence: TLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKD

• Applicable Applications for anti-MAK antibody: Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: WB: 1:500-1:2000; IHC: 1:50-1:100; IF: 1:50-1:100
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 370-435 of human MAK (NP_005897.1).
• Positive Samples: Mouse lung, Rat lung
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using MAK antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human liver using MAK antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using MAK antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human placenta using MAK antibody at dilution of 1:100 (40x lens).)

Related Product Information for anti-MAK antibody

Background: The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. Mutations in this gene have been associated with ciliary defects resulting in retinitis pigmentosa 62. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

NCBI and Uniprot Product Information

• NCBI GI #: 334724436
• NCBI GeneID: 4117
• NCBI Accession #: NP_001229314.1
• NCBI GenBank Nucleotide #: NM_001242385.1
• UniProt Accession #: P20794; Q547D0; Q9NUH7; F1T0K6; G1FL29
• Molecular Weight: 70,581 Da
• NCBI Official Full Name: serine/threonine-protein kinase MAK isoform 2
• NCBI Official Synonym Full Names: male germ cell-associated kinase
• NCBI Official Symbol: MAK
• NCBI Official Synonym Symbols: RP62; dJ417M14.2
• NCBI Protein Information: serine/threonine-protein kinase MAK; serine/threonine protein kinase MAK; male germ cell-associated kinase retinal-enriched isoform
• UniProt Protein Name: Serine/threonine-protein kinase MAK
• Protein Family: Makatoxin
• UniProt Gene Name: MAK
• UniProt Entry Name: MAK_HUMAN

NCBI Description

The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]

Uniprot Description

MAK: a protein kinase of the RCK family of kinases. It is expressed at high levels in the testis (primarily in germ cells), and in developing sensory epithelia. Localizes to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.22; Nuclear receptor co-regulator; Protein kinase, CMGC; CMGC group; RCK family

Chromosomal Location of Human Ortholog: 6p24

Cellular Component: centrosome; photoreceptor outer segment; photoreceptor inner segment; cytoplasm; midbody; nucleus

Molecular Function: protein binding; cyclin-dependent protein kinase activity; transcription coactivator activity; ATP binding; protein kinase activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; regulation of cell cycle; multicellular organismal development; protein amino acid autophosphorylation; photoreceptor cell maintenance; spermatogenesis; cell differentiation; protein amino acid phosphorylation

Disease: Retinitis Pigmentosa 62