Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-MAGEH1 Polyclonal Antibody)

Rabbit anti-Mouse MAGEH1 Polyclonal Antibody | anti-MAGEH1 antibody

MAGEH1 Polyclonal Antibody

Gene Names
MAGEH1; APR1; APR-1; MAGEH
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
MAGEH1; Polyclonal Antibody; MAGEH1 Polyclonal Antibody; APR-1; APR1; MAGEH; MAGE family member H1; anti-MAGEH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.27 mg/ml (varies by lot)
Sequence Length
219
Applicable Applications for anti-MAGEH1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human MAGEH1 (NP_054780.2).
Immunogen Sequence
RRNARAAEENRNNRKIQASEASETPMAASVVASTPEDDLSGPEEDPSTPEEASTTPEEASSTAQAQKPSVPRSNFQGTKKS
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-MAGEH1 Polyclonal Antibody)

Western Blot (WB) (Western blot-MAGEH1 Polyclonal Antibody)
Related Product Information for anti-MAGEH1 antibody
This gene belongs to the non-CT (non cancer/testis) subgroup of the melanoma-associated antigen (MAGE) superfamily. The encoded protein is likely associated with apoptosis, cell cycle arrest, growth inhibition or cell differentiation. The protein may be involved in the atRA (all-trans retinoic acid) signaling through the STAT1-alpha (signal transducer and activator of transcription 1-alpha) pathway.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
melanoma-associated antigen H1
NCBI Official Synonym Full Names
MAGE family member H1
NCBI Official Symbol
MAGEH1
NCBI Official Synonym Symbols
APR1; APR-1; MAGEH
NCBI Protein Information
melanoma-associated antigen H1
UniProt Protein Name
Melanoma-associated antigen H1
UniProt Gene Name
MAGEH1
UniProt Synonym Gene Names
APR1; APR-1
UniProt Entry Name
MAGH1_HUMAN

NCBI Description

This gene belongs to the non-CT (non cancer/testis) subgroup of the melanoma-associated antigen (MAGE) superfamily. The encoded protein is likely associated with apoptosis, cell cycle arrest, growth inhibition or cell differentiation. The protein may be involved in the atRA (all-trans retinoic acid) signaling through the STAT1-alpha (signal transducer and activator of transcription 1-alpha) pathway. [provided by RefSeq, Aug 2013]

Uniprot Description

MAGE-H1:

Chromosomal Location of Human Ortholog: Xp11.21

Cellular Component: cytoplasm

Biological Process: apoptosis

Research Articles on MAGEH1

Similar Products

Product Notes

The MAGEH1 mageh1 (Catalog #AAA9141053) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAGEH1 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MAGEH1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the MAGEH1 mageh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAGEH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.