Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MAGEF1 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole CellMAGEF1 is supported by BioGPS gene expression data to be expressed in NCIH226)

Rabbit MAGEF1 Polyclonal Antibody | anti-MAGEF1 antibody

MAGEF1 antibody - C-terminal region

Gene Names
MAGEF1; MAGE-F1
Reactivity
Cow, Dog, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MAGEF1; Polyclonal Antibody; MAGEF1 antibody - C-terminal region; anti-MAGEF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YRRVPHTNPPEYEFSWGPRSNLEISKMEVLGFVAKLHKKEPQHWPVQYRE
Sequence Length
307
Applicable Applications for anti-MAGEF1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Pig: 100%; Rabbit: 77%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MAGEF1 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole CellMAGEF1 is supported by BioGPS gene expression data to be expressed in NCIH226)

Western Blot (WB) (WB Suggested Anti-MAGEF1 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole CellMAGEF1 is supported by BioGPS gene expression data to be expressed in NCIH226)
Related Product Information for anti-MAGEF1 antibody
This is a rabbit polyclonal antibody against MAGEF1. It was validated on Western Blot

Target Description: This intronless gene encodes a member of the MAGE superfamily. It is ubiquitously expressed in normal tissues and in tumor cells. This gene includes a microsatellite repeat in the coding region.
Product Categories/Family for anti-MAGEF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
melanoma-associated antigen F1
NCBI Official Synonym Full Names
MAGE family member F1
NCBI Official Symbol
MAGEF1
NCBI Official Synonym Symbols
MAGE-F1
NCBI Protein Information
melanoma-associated antigen F1
UniProt Protein Name
Melanoma-associated antigen F1
UniProt Gene Name
MAGEF1
UniProt Entry Name
MAGF1_HUMAN

NCBI Description

This intronless gene encodes a member of the MAGE superfamily. It is ubiquitously expressed in normal tissues and in tumor cells. This gene includes a microsatellite repeat in the coding region. [provided by RefSeq, Jul 2008]

Uniprot Description

MAGE-F1: May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex.

Chromosomal Location of Human Ortholog: 3q13

Research Articles on MAGEF1

Similar Products

Product Notes

The MAGEF1 magef1 (Catalog #AAA3215770) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAGEF1 antibody - C-terminal region reacts with Cow, Dog, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's MAGEF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAGEF1 magef1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YRRVPHTNPP EYEFSWGPRS NLEISKMEVL GFVAKLHKKE PQHWPVQYRE. It is sometimes possible for the material contained within the vial of "MAGEF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.