Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LYVE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Rabbit LYVE1 Polyclonal Antibody | anti-LYVE1 antibody

LYVE1 antibody - N-terminal region

Gene Names
LYVE1; HAR; XLKD1; LYVE-1; CRSBP-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LYVE1; Polyclonal Antibody; LYVE1 antibody - N-terminal region; anti-LYVE1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ
Sequence Length
322
Applicable Applications for anti-LYVE1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LYVE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LYVE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-LYVE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
Related Product Information for anti-LYVE1 antibody
This is a rabbit polyclonal antibody against LYVE1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LYVE1 is a type I integral membrane glycoprotein. It acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
lymphatic vessel endothelial hyaluronic acid receptor 1
NCBI Official Synonym Full Names
lymphatic vessel endothelial hyaluronan receptor 1
NCBI Official Symbol
LYVE1
NCBI Official Synonym Symbols
HAR; XLKD1; LYVE-1; CRSBP-1
NCBI Protein Information
lymphatic vessel endothelial hyaluronic acid receptor 1
UniProt Protein Name
Lymphatic vessel endothelial hyaluronic acid receptor 1
UniProt Gene Name
LYVE1
UniProt Synonym Gene Names
CRSBP1; HAR; XLKD1; LYVE-1; CRSBP-1
UniProt Entry Name
LYVE1_HUMAN

NCBI Description

This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis. [provided by RefSeq, Jul 2008]

Uniprot Description

XLKD1: Ligand-specific transporter trafficking between intracellular organelles (TGN) and the plasma membrane. Plays a role in autocrine regulation of cell growth mediated by growth regulators containing cell surface retention sequence binding (CRS). May act as an hyaluronan (HA) transporter, either mediating its uptake for catabolism within lymphatic endothelial cells themselves, or its transport into the lumen of afferent lymphatic vessels for subsequent re-uptake and degradation in lymph nodes.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11p15

Cellular Component: membrane; integral to plasma membrane; plasma membrane

Molecular Function: transmembrane receptor activity; hyaluronic acid binding; receptor activity

Biological Process: anatomical structure morphogenesis; glycosaminoglycan metabolic process; transport; cell-matrix adhesion; carbohydrate metabolic process; response to wounding; pathogenesis; cell motility; signal transduction; hyaluronan metabolic process; hyaluronan catabolic process

Research Articles on LYVE1

Similar Products

Product Notes

The LYVE1 lyve1 (Catalog #AAA3208319) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LYVE1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's LYVE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LYVE1 lyve1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ARCFSLVLLL TSIWTTRLLV QGSLRAEELS IQVSCRIMGI TLVSKKANQQ. It is sometimes possible for the material contained within the vial of "LYVE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.