Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LYPLAL1 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)

Rabbit LYPLAL1 Polyclonal Antibody | anti-LYPLAL1 antibody

LYPLAL1 Antibody - middle region

Gene Names
LYPLAL1; Q96AV0
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LYPLAL1; Polyclonal Antibody; LYPLAL1 Antibody - middle region; anti-LYPLAL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFA
Sequence Length
237
Applicable Applications for anti-LYPLAL1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 79%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human LYPLAL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LYPLAL1 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)

Western Blot (WB) (WB Suggested Anti-LYPLAL1 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
Related Product Information for anti-LYPLAL1 antibody
This is a rabbit polyclonal antibody against LYPLAL1. It was validated on Western Blot

Target Description: LYPLAL1 does not exhibit phospholipase nor triacylglycerol lipase activity. It is able to hydrolyze only short chain substrates due to its shallow active site.
Product Categories/Family for anti-LYPLAL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
lysophospholipase-like protein 1 isoform a
NCBI Official Synonym Full Names
lysophospholipase like 1
NCBI Official Symbol
LYPLAL1
NCBI Official Synonym Symbols
Q96AV0
NCBI Protein Information
lysophospholipase-like protein 1
UniProt Protein Name
Lysophospholipase-like protein 1
UniProt Gene Name
LYPLAL1
UniProt Entry Name
LYPL1_HUMAN

Uniprot Description

LYPLAL1: Does not exhibit phospholipase nor triacylglycerol lipase activity, able to hydrolyze only short chain substrates due to its shallow active site. Belongs to the AB hydrolase 2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.2.-; Phospholipase

Chromosomal Location of Human Ortholog: 1q41

Cellular Component: cytoplasm; cytosol

Molecular Function: lysophospholipase activity

Biological Process: negative regulation of Golgi to plasma membrane protein transport; protein depalmitoylation

Research Articles on LYPLAL1

Similar Products

Product Notes

The LYPLAL1 lyplal1 (Catalog #AAA3217029) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LYPLAL1 Antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's LYPLAL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LYPLAL1 lyplal1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MCQVLTDLID EEVKSGIKKN RILIGGFSMG GCMAMHLAYR NHQDVAGVFA. It is sometimes possible for the material contained within the vial of "LYPLAL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.