Western Blot (WB)
(WB Suggested Anti-LYPD6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)
Rabbit LYPD6 Polyclonal Antibody | anti-LYPD6 antibody
LYPD6 antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LYPD6; Polyclonal Antibody; LYPD6 antibody - middle region; anti-LYPD6 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS
Sequence Length
171
Applicable Applications for anti-LYPD6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LYPD6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-LYPD6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)
Western Blot (WB)
(WB Suggested Anti-LYPD6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)
Related Product Information for anti-LYPD6 antibody
This is a rabbit polyclonal antibody against LYPD6. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: LYPD6 contains 1 UPAR/Ly6 domain. The exact function of LYPD6 is not known.
Target Description: LYPD6 contains 1 UPAR/Ly6 domain. The exact function of LYPD6 is not known.
Product Categories/Family for anti-LYPD6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
ly6/PLAUR domain-containing protein 6
NCBI Official Synonym Full Names
LY6/PLAUR domain containing 6
NCBI Official Symbol
LYPD6
NCBI Protein Information
ly6/PLAUR domain-containing protein 6
UniProt Protein Name
Ly6/PLAUR domain-containing protein 6
Protein Family
UniProt Gene Name
LYPD6
UniProt Synonym Gene Names
UNQ3023/PRO9821
UniProt Entry Name
LYPD6_HUMAN
NCBI Description
Members of the LY6 protein family (see SLURP1; MIM 606119), such as LYPD6, have at least one 80-amino acid LU domain that contains 10 conserved cysteines with a defined disulfide-bonding pattern (Zhang et al., 2010 [PubMed 19653121]).[supplied by OMIM, Apr 2010]
Research Articles on LYPD6
Similar Products
Product Notes
The LYPD6 lypd6 (Catalog #AAA3211317) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LYPD6 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LYPD6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LYPD6 lypd6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RDSEHEGHKV CTSCCEGNIC NLPLPRNETD ATFATTSPIN QTNGHPRCMS. It is sometimes possible for the material contained within the vial of "LYPD6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
