Western Blot (WB)
(Host: MouseTarget Name: LXNSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Rabbit LXN Polyclonal Antibody | anti-LXN antibody
LXN antibody - N-terminal region
Gene Names
LXN; ECI; TCI
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LXN; Polyclonal Antibody; LXN antibody - N-terminal region; anti-LXN antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLE
Sequence Length
222
Applicable Applications for anti-LXN antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: MouseTarget Name: LXNSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: MouseTarget Name: LXNSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-LXN AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellLXN is supported by BioGPS gene expression data to be expressed in MCF7)
Western Blot (WB)
(WB Suggested Anti-LXN AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellLXN is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-LXN antibody
This is a rabbit polyclonal antibody against LXN. It was validated on Western Blot
Target Description: This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases.
Target Description: This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases.
Product Categories/Family for anti-LXN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
latexin
NCBI Official Synonym Full Names
latexin
NCBI Official Symbol
LXN
NCBI Official Synonym Symbols
ECI; TCI
NCBI Protein Information
latexin
UniProt Protein Name
Latexin
Protein Family
UniProt Gene Name
LXN
UniProt Synonym Gene Names
ECI; TCI
UniProt Entry Name
LXN_HUMAN
NCBI Description
This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases. [provided by RefSeq, Oct 2008]
Uniprot Description
LXN: Hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. Belongs to the protease inhibitor I47 (latexin) family.
Chromosomal Location of Human Ortholog: 3q25.32
Cellular Component: cytoplasm
Molecular Function: metalloendopeptidase inhibitor activity; heparin binding
Biological Process: detection of temperature stimulus involved in sensory perception of pain; inflammatory response
Research Articles on LXN
Similar Products
Product Notes
The LXN lxn (Catalog #AAA3216680) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LXN antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LXN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LXN lxn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NCTAEVLYPS TGQETAPEVN FTFEGETGKN PDEEDNTFYQ RLKSMKEPLE. It is sometimes possible for the material contained within the vial of "LXN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
