Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LUMSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Rabbit LUM Polyclonal Antibody | anti-LUM antibody

LUM antibody - middle region

Gene Names
LUM; LDC; SLRR2D
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LUM; Polyclonal Antibody; LUM antibody - middle region; anti-LUM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRF
Sequence Length
338
Applicable Applications for anti-LUM antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LUM
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LUMSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: LUMSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-LUM Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-LUM Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)
Related Product Information for anti-LUM antibody
This is a rabbit polyclonal antibody against LUM. It was validated on Western Blot

Target Description: This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair.
Product Categories/Family for anti-LUM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
lumican
NCBI Official Synonym Full Names
lumican
NCBI Official Symbol
LUM
NCBI Official Synonym Symbols
LDC; SLRR2D
NCBI Protein Information
lumican
UniProt Protein Name
Lumican
Protein Family
UniProt Gene Name
LUM
UniProt Synonym Gene Names
LDC; SLRR2D; KSPG lumican
UniProt Entry Name
LUM_HUMAN

NCBI Description

This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. [provided by RefSeq, Jul 2008]

Uniprot Description

LUM: a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. [provided by RefSeq, Jul 2008]

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 12q21.33

Cellular Component: extracellular matrix; extracellular space; lysosomal lumen; proteinaceous extracellular matrix; fibrillar collagen; Golgi lumen; extracellular region

Molecular Function: collagen binding; protein binding; extracellular matrix structural constituent

Biological Process: keratan sulfate metabolic process; extracellular matrix organization and biogenesis; collagen fibril organization; glycosaminoglycan metabolic process; visual perception; cartilage development; keratan sulfate biosynthetic process; carbohydrate metabolic process; positive regulation of transcription from RNA polymerase II promoter; pathogenesis; keratan sulfate catabolic process; response to organic cyclic substance

Research Articles on LUM

Similar Products

Product Notes

The LUM lum (Catalog #AAA3211807) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LUM antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LUM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LUM lum for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AFKGLKSLEY LDLSFNQIAR LPSGLPVSLL TLYLDNNKIS NIPDEYFKRF. It is sometimes possible for the material contained within the vial of "LUM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.