Western Blot (WB)
(WB Suggested Anti-LSM5 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellLSM5 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Rabbit LSM5 Polyclonal Antibody | anti-LSM5 antibody
LSM5 Antibody - middle region
Gene Names
LSM5; YER146W
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LSM5; Polyclonal Antibody; LSM5 Antibody - middle region; anti-LSM5 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV
Sequence Length
91
Applicable Applications for anti-LSM5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human LSM5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-LSM5 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellLSM5 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Western Blot (WB)
(WB Suggested Anti-LSM5 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellLSM5 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Related Product Information for anti-LSM5 antibody
This is a rabbit polyclonal antibody against LSM5. It was validated on Western Blot
Target Description: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
Target Description: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
Product Categories/Family for anti-LSM5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
U6 snRNA-associated Sm-like protein LSm5 isoform a
NCBI Official Synonym Full Names
LSM5 homolog, U6 small nuclear RNA and mRNA degradation associated
NCBI Official Symbol
LSM5
NCBI Official Synonym Symbols
YER146W
NCBI Protein Information
U6 snRNA-associated Sm-like protein LSm5
UniProt Protein Name
U6 snRNA-associated Sm-like protein LSm5
Protein Family
UniProt Gene Name
LSM5
NCBI Description
Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM, Apr 2004]
Uniprot Description
Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA, thereby facilitating formation of the spliceosomal U4/U6 duplex formation in vitro.
Research Articles on LSM5
Similar Products
Product Notes
The LSM5 lsm5 (Catalog #AAA3217266) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LSM5 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LSM5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LSM5 lsm5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GFDDFVNMVL EDVTEFEITP EGRRITKLDQ ILLNGNNITM LVPGGEGPEV. It is sometimes possible for the material contained within the vial of "LSM5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
