Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-LPIN1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit LPIN1 Polyclonal Antibody | anti-LPIN1 antibody

LPIN1 antibody - N-terminal region

Gene Names
LPIN1; PAP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
LPIN1; Polyclonal Antibody; LPIN1 antibody - N-terminal region; anti-LPIN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK
Sequence Length
890
Applicable Applications for anti-LPIN1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 91%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LPIN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-LPIN1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-LPIN1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-LPIN1 antibody
This is a rabbit polyclonal antibody against LPIN1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that LPIN1 functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
phosphatidate phosphatase LPIN1 isoform 1
NCBI Official Synonym Full Names
lipin 1
NCBI Official Symbol
LPIN1
NCBI Official Synonym Symbols
PAP1
NCBI Protein Information
phosphatidate phosphatase LPIN1
UniProt Protein Name
Phosphatidate phosphatase LPIN1
Protein Family
UniProt Gene Name
LPIN1
UniProt Synonym Gene Names
KIAA0188
UniProt Entry Name
LPIN1_HUMAN

NCBI Description

This gene encodes a magnesium-ion-dependent phosphatidic acid phosphohydrolase enzyme that catalyzes the penultimate step in triglyceride synthesis including the dephosphorylation of phosphatidic acid to yield diacylglycerol. Expression of this gene is required for adipocyte differentiation and it also functions as a nuclear transcriptional coactivator with some peroxisome proliferator-activated receptors to modulate expression of other genes involved in lipid metabolism. Mutations in this gene are associated with metabolic syndrome, type 2 diabetes, acute recurrent rhabdomyolysis, and autosomal recessive acute recurrent myoglobinuria (ARARM). This gene is also a candidate for several human lipodystrophy syndromes. [provided by RefSeq, Mar 2017]

Uniprot Description

LPIN1: Plays important roles in controlling the metabolism of fatty acids at differents levels. Acts as a magnesium-dependent phosphatidate phosphatase enzyme which catalyzes the conversion of phosphatidic acid to diacylglycerol during triglyceride, phosphatidylcholine and phosphatidylethanolamine biosynthesis in the reticulum endoplasmic membrane. Acts also as a nuclear transcriptional coactivator for PPARGC1A/PPARA to modulate lipid metabolism gene expression. Is involved in adipocyte differentiation. May also be involved in mitochondrial fission by converting phosphatidic acid to diacylglycerol. Interacts (via LXXIL motif) with PPARA. Interacts with PPARGC1A. Interaction with PPARA and PPARGC1A leads to the formation of a complex that modulates gene transcription. Interacts with MEF2C. Specifically expressed in skeletal muscle. Also abundant in adipose tissue. Lower levels in some portions of the digestive tract. Inhibited by N-ethylmaleimide. Belongs to the lipin family.

Protein type: EC 3.1.3.4; Phosphatase, lipid

Chromosomal Location of Human Ortholog: 2p25.1

Cellular Component: nucleoplasm; endoplasmic reticulum membrane; mitochondrial outer membrane; transcription factor complex; nuclear membrane; cytoplasm; nuclear envelope; cytosol; nucleus

Molecular Function: peroxisome proliferator activated receptor binding; phosphatidate phosphatase activity; histone deacetylase binding; transcription coactivator activity

Biological Process: mitochondrial fission; organ regeneration; transcription, DNA-dependent; regulation of fat cell differentiation; phosphatidylethanolamine biosynthetic process; glycerophospholipid biosynthetic process; mitotic nuclear envelope disassembly; triacylglycerol biosynthetic process; negative regulation of transcription from RNA polymerase II promoter; cellular lipid metabolic process; fatty acid catabolic process; positive regulation of histone deacetylation; cellular response to insulin stimulus; dephosphorylation; phospholipid metabolic process; actin cytoskeleton reorganization; phosphatidylcholine biosynthetic process; ruffle organization and biogenesis; positive regulation of transcription from RNA polymerase II promoter; mitotic cell cycle; triacylglycerol mobilization

Disease: Myoglobinuria, Acute Recurrent, Autosomal Recessive

Research Articles on LPIN1

Similar Products

Product Notes

The LPIN1 lpin1 (Catalog #AAA3211538) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LPIN1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LPIN1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the LPIN1 lpin1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLAVIYPQSA SYPNSDREWS PTPSPSGSRP STPKSDSELV SKSTERTGQK. It is sometimes possible for the material contained within the vial of "LPIN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.