Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LPAR4 AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole CellLPAR4 is supported by BioGPS gene expression data to be expressed in RPMI 8226)

Rabbit LPAR4 Polyclonal Antibody | anti-LPAR4 antibody

LPAR4 antibody - C-terminal region

Gene Names
LPAR4; LPA4; P2Y9; GPR23; P2RY9; P2Y5-LIKE
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LPAR4; Polyclonal Antibody; LPAR4 antibody - C-terminal region; anti-LPAR4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF
Sequence Length
370
Applicable Applications for anti-LPAR4 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 86%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LPAR4 AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole CellLPAR4 is supported by BioGPS gene expression data to be expressed in RPMI 8226)

Western Blot (WB) (WB Suggested Anti-LPAR4 AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole CellLPAR4 is supported by BioGPS gene expression data to be expressed in RPMI 8226)
Related Product Information for anti-LPAR4 antibody
This is a rabbit polyclonal antibody against LPAR4. It was validated on Western Blot

Target Description: This gene encodes a member of the lysophosphatidic acid receptor family. It may also be related to the P2Y receptors, a family of receptors that bind purine and pyrimidine nucleotides and are coupled to G proteins. The encoded protein may play a role in monocytic differentiation.
Product Categories/Family for anti-LPAR4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
lysophosphatidic acid receptor 4
NCBI Official Synonym Full Names
lysophosphatidic acid receptor 4
NCBI Official Symbol
LPAR4
NCBI Official Synonym Symbols
LPA4; P2Y9; GPR23; P2RY9; P2Y5-LIKE
NCBI Protein Information
lysophosphatidic acid receptor 4
UniProt Protein Name
Lysophosphatidic acid receptor 4
UniProt Gene Name
LPAR4
UniProt Synonym Gene Names
GPR23; LPA4; P2RY9; LPA receptor 4; LPA-4; P2Y9
UniProt Entry Name
LPAR4_HUMAN

NCBI Description

This gene encodes a member of the lysophosphatidic acid receptor family. It may also be related to the P2Y receptors, a family of receptors that bind purine and pyrimidine nucleotides and are coupled to G proteins. The encoded protein may play a role in monocytic differentiation. [provided by RefSeq, Feb 2009]

Uniprot Description

LPAR4: Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Transduces a signal by increasing the intracellular calcium ions and by stimulating adenylyl cyclase activity. The rank order of potency for agonists of this receptor is 1-oleoyl- > 1-stearoyl- > 1-palmitoyl- > 1-myristoyl- > 1- alkyl- > 1-alkenyl-LPA. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xq21.1

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; lipid binding

Biological Process: G-protein coupled receptor protein signaling pathway

Research Articles on LPAR4

Similar Products

Product Notes

The LPAR4 lpar4 (Catalog #AAA3216520) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LPAR4 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LPAR4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LPAR4 lpar4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SFYINAHIRM ESLFKTETPL TTKPSLPAIQ EEVSDQTTNN GGELMLESTF. It is sometimes possible for the material contained within the vial of "LPAR4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.