Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LPAR1Sample Tissue: Human Testicular Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human LPAR1 Polyclonal Antibody | anti-LPAR1 antibody

LPAR1 Antibody - C-terminal region

Gene Names
LPAR1; EDG2; LPA1; VZG1; GPR26; edg-2; vzg-1; Gpcr26; Mrec1.3; rec.1.3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
LPAR1; Polyclonal Antibody; LPAR1 Antibody - C-terminal region; anti-LPAR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGV
Sequence Length
364
Applicable Applications for anti-LPAR1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human LPAR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LPAR1Sample Tissue: Human Testicular Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: LPAR1Sample Tissue: Human Testicular Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-LPAR1 antibody
The integral membrane protein encoded by this gene is a lysophosphatidic acid (LPA) receptor from a group known as EDG receptors. These receptors are members of the G protein-coupled receptor superfamily. Utilized by LPA for cell signaling, EDG receptors mediate diverse biologic functions, including proliferation, platelet aggregation, smooth muscle contraction, inhibition of neuroblastoma cell differentiation, chemotaxis, and tumor cell invasion. Two transcript variants encoding the same protein have been identified for this gene

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
lysophosphatidic acid receptor 1
NCBI Official Synonym Full Names
lysophosphatidic acid receptor 1
NCBI Official Symbol
LPAR1
NCBI Official Synonym Symbols
EDG2; LPA1; VZG1; GPR26; edg-2; vzg-1; Gpcr26; Mrec1.3; rec.1.3
NCBI Protein Information
lysophosphatidic acid receptor 1
UniProt Protein Name
Lysophosphatidic acid receptor 1
UniProt Gene Name
LPAR1
UniProt Synonym Gene Names
EDG2; LPA1; LPA receptor 1; LPA-1
UniProt Entry Name
LPAR1_HUMAN

NCBI Description

The integral membrane protein encoded by this gene is a lysophosphatidic acid (LPA) receptor from a group known as EDG receptors. These receptors are members of the G protein-coupled receptor superfamily. Utilized by LPA for cell signaling, EDG receptors mediate diverse biologic functions, including proliferation, platelet aggregation, smooth muscle contraction, inhibition of neuroblastoma cell differentiation, chemotaxis, and tumor cell invasion. Two transcript variants encoding the same protein have been identified for this gene [provided by RefSeq, Jul 2008]

Uniprot Description

LPAR1: Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Seems to be coupled to the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Stimulates phospholipase C (PLC) activity in a manner that is dependent on RALA activation. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 9q31.3

Cellular Component: cell surface; endocytic vesicle; integral to plasma membrane; plasma membrane; dendritic spine; dendritic shaft

Molecular Function: G-protein coupled receptor activity; protein binding; phospholipid binding; G-protein alpha-subunit binding; PDZ domain binding

Biological Process: myelination; G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); positive regulation of I-kappaB kinase/NF-kappaB cascade; activation of MAPK activity; positive regulation of apoptosis; phospholipase C activation; positive regulation of Rho protein signal transduction; bleb formation

Research Articles on LPAR1

Similar Products

Product Notes

The LPAR1 lpar1 (Catalog #AAA3222449) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LPAR1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LPAR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LPAR1 lpar1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NPIIYSYRDK EMSATFRQIL CCQRSENPTG PTEGSDRSAS SLNHTILAGV. It is sometimes possible for the material contained within the vial of "LPAR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.