Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of OLR1 expression in transfected 293T cell line by OLR1 polyclonal antibody. Lane 1: OLR1 transfected lysate (31kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human LOX1 Polyclonal Antibody | anti-LOX1 antibody

LOX1 (Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, C-type Lectin Domain Family 8 Member A, Lectin-like Oxidized LDL Receptor 1, LOX-1, Lectin-like oxLDL Receptor 1, hLOX-1, Lectin-type Oxidized LDL Receptor 1, OLR1, CLEC8A) (PE)

Gene Names
OLR1; LOX1; LOXIN; SLOX1; CLEC8A; SCARE1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LOX1; Polyclonal Antibody; LOX1 (Oxidized Low-density Lipoprotein Receptor 1; Ox-LDL Receptor 1; C-type Lectin Domain Family 8 Member A; Lectin-like Oxidized LDL Receptor 1; LOX-1; Lectin-like oxLDL Receptor 1; hLOX-1; Lectin-type Oxidized LDL Receptor 1; OLR1; CLEC8A) (PE); anti-LOX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human OLR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-LOX1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human OLR1, aa1-273 (NP_002534.1).
Immunogen Sequence
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of OLR1 expression in transfected 293T cell line by OLR1 polyclonal antibody. Lane 1: OLR1 transfected lysate (31kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of OLR1 expression in transfected 293T cell line by OLR1 polyclonal antibody. Lane 1: OLR1 transfected lysate (31kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LOX1 antibody
OLR1, is a type II membrane protein that is a member of the C-type lectin family and acts as a cell-surface receptor for Ox-LDL. Ox-LDL plays a role in early ather-osclerosis, which includes the transformation of monocyte-derived macro-phages to foam cells in atherosclerotic lesions. This protein may also trigger the activation of the NFkB signal transduction pathway.
Product Categories/Family for anti-LOX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,959 Da
NCBI Official Full Name
oxidized low-density lipoprotein receptor 1 isoform 1
NCBI Official Synonym Full Names
oxidized low density lipoprotein (lectin-like) receptor 1
NCBI Official Symbol
OLR1
NCBI Official Synonym Symbols
LOX1; LOXIN; SLOX1; CLEC8A; SCARE1
NCBI Protein Information
oxidized low-density lipoprotein receptor 1; hLOX-1; ox LDL receptor 1; lectin-type oxidized LDL receptor 1; scavenger receptor class E, member 1; C-type lectin domain family 8 member A; oxidized low-density lipoprotein receptor 1, soluble form
UniProt Protein Name
Oxidized low-density lipoprotein receptor 1
UniProt Gene Name
OLR1
UniProt Synonym Gene Names
CLEC8A; LOX1; Ox-LDL receptor 1; LOX-1; Lectin-like oxLDL receptor 1; hLOX-1
UniProt Entry Name
OLR1_HUMAN

NCBI Description

This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2010]

Uniprot Description

OLR1: Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro- oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro- atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram- positive bacteria. Independent association genetic studies have implicated OLR1 gene variants in myocardial infarction susceptibility. OLR1 may be involved in Alzheimer disease (AD). Involvement in AD is however unclear: according to some authors (PubMed:12354387, PubMed:12810610 and PubMed:15976314), variations in OLR1 modify the risk of AD, while according to other (PubMed:15000751 and PubMed:15060104) they do not. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13.2-p12.3

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; membrane; integral to plasma membrane; plasma membrane; receptor complex; lipid raft

Molecular Function: low-density lipoprotein receptor activity; protein binding; carbohydrate binding

Biological Process: cell death; receptor-mediated endocytosis; leukocyte adhesion; response to hydrogen peroxide; blood circulation; lipoprotein metabolic process; proteolysis; blood coagulation; inflammatory response; leukocyte migration

Disease: Myocardial Infarction, Susceptibility To

Research Articles on LOX1

Similar Products

Product Notes

The LOX1 olr1 (Catalog #AAA6384366) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LOX1 (Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, C-type Lectin Domain Family 8 Member A, Lectin-like Oxidized LDL Receptor 1, LOX-1, Lectin-like oxLDL Receptor 1, hLOX-1, Lectin-type Oxidized LDL Receptor 1, OLR1, CLEC8A) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LOX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LOX1 olr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LOX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.