Western Blot (WB)
(Western blot-LNX2 Polyclonal Antibody)
Rabbit LNX2 Polyclonal Antibody | anti-LNX2 antibody
LNX2 Polyclonal Antibody
Gene Names
LNX2; PDZRN1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
LNX2; Polyclonal Antibody; LNX2 Polyclonal Antibody; PDZRN1; ligand of Numb protein X 2; anti-LNX2 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.72 mg/ml (varies by lot)
Sequence Length
690
Applicable Applications for anti-LNX2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human LNX2 (NP_699202.1).
Immunogen Sequence
MGTTSDEMVSVEQTSSSSLNPLCFECGQQHWTRENHLYNYQNEVDDDLVCHICLQPLLQPLDTPCGHTFCYKCLRNFLQEKDFCPLDRKRLHFKLCKKSSILVHKLLDKLLVLCPFSSVCKDVMQRCDLEAHLKNRCPGASHRRVALERRKTSRTQAEIENENGPTLLDPAGTLSPEADCLGTGAVPVERHLTSASLSTWSEEPGLDNPAFEESAGADTTQQPLSLPEGEITTIEIHRSN
Positive Samples
A-375, A-549, Rat Thymus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-LNX2 Polyclonal Antibody)
Western Blot (WB)
(Western blot-LNX2 Polyclonal Antibody)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 76kDa
Observed: 76kDa
Observed: 76kDa
NCBI Official Full Name
ligand of Numb protein X 2
NCBI Official Synonym Full Names
ligand of numb-protein X 2
NCBI Official Symbol
LNX2
NCBI Official Synonym Symbols
PDZRN1
NCBI Protein Information
ligand of Numb protein X 2
UniProt Protein Name
Ligand of Numb protein X 2
Protein Family
UniProt Gene Name
LNX2
UniProt Synonym Gene Names
PDZRN1
UniProt Entry Name
LNX2_HUMAN
Uniprot Description
Subunit structure: Interacts with the phosphotyrosine interaction domain of NUMB
By similarity.
Domain: The NPXY motif is required for the interaction with the PID domain of NUMB. It is however not sufficient.
Sequence similarities: Contains 4 PDZ (DHR) domains.Contains 1 RING-type zinc finger.
Sequence caution: The sequence BAD18754.1 differs from that shown. Reason: Erroneous initiation.
Research Articles on LNX2
Similar Products
Product Notes
The LNX2 lnx2 (Catalog #AAA9140947) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LNX2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LNX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the LNX2 lnx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LNX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
