Western Blot (WB)
(WB Suggested Anti-LIPK AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Rabbit anti-Human LIPK Polyclonal Antibody | anti-LIPK antibody
LIPK Antibody - N-terminal region
Gene Names
LIPK; LIPL2; bA186O14.2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LIPK; Polyclonal Antibody; LIPK Antibody - N-terminal region; anti-LIPK antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLGSMYGYDKKGNNANPEANMNISQIISYWGYPYEEYDVTTKDGYILGIY
Sequence Length
399
Applicable Applications for anti-LIPK antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LIPK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-LIPK AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-LIPK AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-LIPK antibody
This is a rabbit polyclonal antibody against LIPK. It was validated on Western Blot
Target Description: LIPK plays a highly specific role in the last step of keratinocyte differentiation. It may have an essential function in lipid metabolism of the most differentiated epidermal layers.
Target Description: LIPK plays a highly specific role in the last step of keratinocyte differentiation. It may have an essential function in lipid metabolism of the most differentiated epidermal layers.
Product Categories/Family for anti-LIPK antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
lipase member K
NCBI Official Synonym Full Names
lipase family member K
NCBI Official Symbol
LIPK
NCBI Official Synonym Symbols
LIPL2; bA186O14.2
NCBI Protein Information
lipase member K
UniProt Protein Name
Lipase member K
Protein Family
UniProt Gene Name
LIPK
UniProt Synonym Gene Names
LIPL2
UniProt Entry Name
LIPK_HUMAN
Uniprot Description
LIPK: Plays a highly specific role in the last step of keratinocyte differentiation. May have an essential function in lipid metabolism of the most differentiated epidermal layers. Belongs to the AB hydrolase superfamily. Lipase family.
Protein type: Secreted; Secreted, signal peptide; EC 3.1.1.-; Hydrolase
Chromosomal Location of Human Ortholog: 10q23.31
Cellular Component: extracellular region
Molecular Function: hydrolase activity, acting on ester bonds
Biological Process: lipid catabolic process
Similar Products
Product Notes
The LIPK lipk (Catalog #AAA3217263) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIPK Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LIPK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LIPK lipk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLGSMYGYDK KGNNANPEAN MNISQIISYW GYPYEEYDVT TKDGYILGIY. It is sometimes possible for the material contained within the vial of "LIPK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
