Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LIPC AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

Rabbit anti-Human LIPC Polyclonal Antibody | anti-LIPC antibody

LIPC Antibody - C-terminal region

Gene Names
LIPC; HL; HTGL; LIPH; HDLCQ12
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LIPC; Polyclonal Antibody; LIPC Antibody - C-terminal region; anti-LIPC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LKTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIKSKTSKRKIR
Sequence Length
499
Applicable Applications for anti-LIPC antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of LIPC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LIPC AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

Western Blot (WB) (WB Suggested Anti-LIPC AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Related Product Information for anti-LIPC antibody
This is a rabbit polyclonal antibody against LIPC. It was validated on Western Blot

Target Description: LIPC encodes hepatic triglyceride lipase, which is expressed in liver. LIPC has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake.
Product Categories/Family for anti-LIPC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
hepatic triacylglycerol lipase
NCBI Official Synonym Full Names
lipase C, hepatic type
NCBI Official Symbol
LIPC
NCBI Official Synonym Symbols
HL; HTGL; LIPH; HDLCQ12
NCBI Protein Information
hepatic triacylglycerol lipase
UniProt Protein Name
Hepatic triacylglycerol lipase
Protein Family
UniProt Gene Name
LIPC
UniProt Synonym Gene Names
HTGL; HL
UniProt Entry Name
LIPC_HUMAN

NCBI Description

LIPC encodes hepatic triglyceride lipase, which is expressed in liver. LIPC has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. [provided by RefSeq, Jul 2008]

Uniprot Description

LIPC: Hepatic lipase has the capacity to catalyze hydrolysis of phospholipids, mono-, di-, and triglycerides, and acyl-CoA thioesters. It is an important enzyme in HDL metabolism. Hepatic lipase binds heparin. Defects in LIPC are the cause of hepatic lipase deficiency (HL deficiency). A disorder characterized by elevated levels of beta-migrating very low density lipoproteins, and abnormally triglyceride-rich low and high density lipoproteins. Belongs to the AB hydrolase superfamily. Lipase family.

Protein type: Secreted, signal peptide; EC 3.1.1.3; Lipid Metabolism - glycerolipid; Phospholipase; Secreted

Chromosomal Location of Human Ortholog: 15q21-q23

Cellular Component: extracellular space

Molecular Function: heparin binding; triacylglycerol lipase activity; low-density lipoprotein binding; apolipoprotein binding; phospholipase activity

Biological Process: cholesterol metabolic process; cholesterol homeostasis; reverse cholesterol transport; triacylglycerol catabolic process; fatty acid biosynthetic process

Disease: High Density Lipoprotein Cholesterol Level Quantitative Trait Locus 12; Hepatic Lipase Deficiency; Diabetes Mellitus, Noninsulin-dependent

Research Articles on LIPC

Similar Products

Product Notes

The LIPC lipc (Catalog #AAA3216031) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIPC Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LIPC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LIPC lipc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKTIRVKAGE TQQRMTFCSE NTDDLLLRPT QEKIFVKCEI KSKTSKRKIR. It is sometimes possible for the material contained within the vial of "LIPC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.