Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (LIPA rabbit polyclonal antibody. Western Blot analysis of LIPA expression in K-562.)

Rabbit anti-Human LIPA Polyclonal Antibody | anti-LIPA antibody

LIPA (Lysosomal Acid Lipase/Cholesteryl Ester Hydrolase, Acid Cholesteryl Ester Hydrolase, LAL, Cholesteryl Esterase, Lipase A, Sterol Esterase) APC

Gene Names
LIPA; LAL; CESD
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LIPA; Polyclonal Antibody; LIPA (Lysosomal Acid Lipase/Cholesteryl Ester Hydrolase; Acid Cholesteryl Ester Hydrolase; LAL; Cholesteryl Esterase; Lipase A; Sterol Esterase) APC; anti-LIPA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LIPA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
2586
Applicable Applications for anti-LIPA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human LIPA, aa1-399 (AAH12287.1).
Immunogen Sequence
MKMRFLGLVVCLVLWPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(LIPA rabbit polyclonal antibody. Western Blot analysis of LIPA expression in K-562.)

Western Blot (WB) (LIPA rabbit polyclonal antibody. Western Blot analysis of LIPA expression in K-562.)

Western Blot (WB)

(Western Blot analysis of LIPA expression in transfected 293T cell line by LIPA polyclonal antibody. Lane 1: LIPA transfected lysate (45.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LIPA expression in transfected 293T cell line by LIPA polyclonal antibody. Lane 1: LIPA transfected lysate (45.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LIPA antibody
Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation.
Product Categories/Family for anti-LIPA antibody
References
1. Characterization of the Niemann-Pick C pathway in alveolar type II cells and lamellar bodies of the lung. Roszell BR, Tao JQ, Yu KJ, Huang S, Bates SR.Am J Physiol Lung Cell Mol Physiol. 2012 May;302(9):L919-32. Epub 2012 Feb 24.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens lipase A, lysosomal acid, cholesterol esterase, mRNA
NCBI Official Synonym Full Names
lipase A, lysosomal acid type
NCBI Official Symbol
LIPA
NCBI Official Synonym Symbols
LAL; CESD
NCBI Protein Information
lysosomal acid lipase/cholesteryl ester hydrolase
Protein Family

NCBI Description

This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2014]

Research Articles on LIPA

Similar Products

Product Notes

The LIPA (Catalog #AAA6384258) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIPA (Lysosomal Acid Lipase/Cholesteryl Ester Hydrolase, Acid Cholesteryl Ester Hydrolase, LAL, Cholesteryl Esterase, Lipase A, Sterol Esterase) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LIPA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LIPA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LIPA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.