Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LIMS2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Rabbit LIMS2 Polyclonal Antibody | anti-LIMS2 antibody

LIMS2 Antibody - N-terminal region

Gene Names
LIMS2; LGMD2W; PINCH2; MDRCMTT; PINCH-2
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LIMS2; Polyclonal Antibody; LIMS2 Antibody - N-terminal region; anti-LIMS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DVELADLGFVKNAGRHLCRPCHNREKAKGLGKYICQRCHLVIDEQPLMFR
Sequence Length
336
Applicable Applications for anti-LIMS2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LIMS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LIMS2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Western Blot (WB) (WB Suggested Anti-LIMS2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Related Product Information for anti-LIMS2 antibody
This is a rabbit polyclonal antibody against LIMS2. It was validated on Western Blot

Target Description: This gene encodes a member of a small family of focal adhesion proteins which interacts with ILK (integrin-linked kinase), a protein which effects protein-protein interactions with the extraceullar matrix. The encoded protein has five LIM domains, each domain forming two zinc fingers, which permit interactions which regulate cell shape and migration. A pseudogene of this gene is located on chromosome 4. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-LIMS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
LIM and senescent cell antigen-like-containing domain protein 2 isoform 5
NCBI Official Synonym Full Names
LIM zinc finger domain containing 2
NCBI Official Symbol
LIMS2
NCBI Official Synonym Symbols
LGMD2W; PINCH2; MDRCMTT; PINCH-2
NCBI Protein Information
LIM and senescent cell antigen-like-containing domain protein 2
UniProt Protein Name
LIM and senescent cell antigen-like-containing domain protein 2
UniProt Gene Name
LIMS2
UniProt Synonym Gene Names
PINCH2; PINCH-2
UniProt Entry Name
LIMS2_HUMAN

NCBI Description

This gene encodes a member of a small family of focal adhesion proteins which interacts with ILK (integrin-linked kinase), a protein which effects protein-protein interactions with the extraceullar matrix. The encoded protein has five LIM domains, each domain forming two zinc fingers, which permit interactions which regulate cell shape and migration. A pseudogene of this gene is located on chromosome 4. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

LIMS2: Competes with LIMS1 for binding to ILK. Plays a role in modulating cell spreading and migration. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 2q14.3

Cellular Component: focal adhesion; plasma membrane; nucleus; cytosol

Molecular Function: zinc ion binding

Biological Process: intercellular junction assembly and maintenance; cell-cell adhesion; negative regulation of apoptosis

Research Articles on LIMS2

Similar Products

Product Notes

The LIMS2 lims2 (Catalog #AAA3216914) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIMS2 Antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LIMS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LIMS2 lims2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DVELADLGFV KNAGRHLCRP CHNREKAKGL GKYICQRCHL VIDEQPLMFR. It is sometimes possible for the material contained within the vial of "LIMS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.