Western Blot (WB)
(Western blot-LETM1 Polyclonal Antibody)
Rabbit LETM1 Polyclonal Antibody | anti-LETM1 antibody
LETM1 Polyclonal Antibody
Gene Names
LETM1; SLC55A1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
LETM1; Polyclonal Antibody; LETM1 Polyclonal Antibody; LETM1 and EF-hand domain-containing protein 1; mitochondrial; anti-LETM1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.06 mg/ml (varies by lot)
Sequence Length
739
Applicable Applications for anti-LETM1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human LETM1 (NP_036450.1).
Immunogen Sequence
MASILLRSCRGRAPARLPPPPRYTVPRGSPGDPAHLSCASTLGLRNCLNVPFGCCTPIHPVYTSSRGDHLGCWALRPECLRIVSRAPWTSTSVGFVAVGPQCLPVRGWHSSRPVRDDSVVEKSLKSLKDKNKKLEEGGPV
Positive Samples
A-431, HeLa, Mouse Heart, Mouse Liver, Rat Brain
Cellular Location
Mitochondrion Inner Membrane, Single-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-LETM1 Polyclonal Antibody)
Western Blot (WB)
(Western blot-LETM1 Polyclonal Antibody)
Related Product Information for anti-LETM1 antibody
This gene encodes a protein that is localized to the inner mitochondrial membrane. The protein functions to maintain the mitochondrial tubular shapes and is required for normal mitochondrial morphology and cellular viability. Mutations in this gene cause Wolf-Hirschhorn syndrome, a complex malformation syndrome caused by the deletion of parts of the distal short arm of chromosome 4. Related pseudogenes have been identified on chromosomes 8, 15 and 19.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 29kDa; 33kDa; 83kDa
Observed: 83kDa
Observed: 83kDa
NCBI Official Full Name
mitochondrial proton/calcium exchanger protein
NCBI Official Synonym Full Names
leucine zipper and EF-hand containing transmembrane protein 1
NCBI Official Symbol
LETM1
NCBI Official Synonym Symbols
SLC55A1
NCBI Protein Information
mitochondrial proton/calcium exchanger protein
UniProt Protein Name
LETM1 and EF-hand domain-containing protein 1, mitochondrial
Protein Family
UniProt Gene Name
LETM1
UniProt Entry Name
LETM1_HUMAN
NCBI Description
This gene encodes a protein that is localized to the inner mitochondrial membrane. The protein functions to maintain the mitochondrial tubular shapes and is required for normal mitochondrial morphology and cellular viability. Mutations in this gene cause Wolf-Hirschhorn syndrome, a complex malformation syndrome caused by the deletion of parts of the distal short arm of chromosome 4. Related pseudogenes have been identified on chromosomes 8, 15 and 19. [provided by RefSeq, Oct 2009]
Research Articles on LETM1
Similar Products
Product Notes
The LETM1 letm1 (Catalog #AAA9140426) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LETM1 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LETM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the LETM1 letm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LETM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
