Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (LDHAL6A polyclonal antibody. Western Blot analysis of LDHAL6A expression in rat brain.)

Mouse anti-Human, Rat LDHAL6A Polyclonal Antibody | anti-LDHAL6A antibody

LDHAL6A (LDHL2, L-lactate Dehydrogenase A-like 6A, MGC23940)

Gene Names
LDHAL6A; LDH6A
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
LDHAL6A; Polyclonal Antibody; LDHAL6A (LDHL2; L-lactate Dehydrogenase A-like 6A; MGC23940); Anti -LDHAL6A (LDHL2; anti-LDHAL6A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LDHAL6A. Species Crossreactivity: rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MATIKSELIKNFAEEEAIHHNKISIVGTGSVGVACAISILLKGLSDELVLVDVDEGKLKGETMDLQHGSPFMKMPNIVSSKDYLVTANSNLVIITAGARQKKGETRLDLVQRNVSIFKLMIPNITQYSPHCKLLIVTNPVDILTYVAWKLSGFPKNRVIGSGCNLDSARFRYFIGQRLGIHSESCHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKK
Applicable Applications for anti-LDHAL6A antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human LDHAL6A, aa1-234 (AAH14340.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(LDHAL6A polyclonal antibody. Western Blot analysis of LDHAL6A expression in rat brain.)

Western Blot (WB) (LDHAL6A polyclonal antibody. Western Blot analysis of LDHAL6A expression in rat brain.)

Western Blot (WB)

(LDHAL6A polyclonal antibody. Western Blot analysis of LDHAL6A expression in Jurkat.)

Western Blot (WB) (LDHAL6A polyclonal antibody. Western Blot analysis of LDHAL6A expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of LDHAL6A expression in transfected 293T cell line by LDHAL6A polyclonal antibody. Lane 1: LDHAL6A transfected lysate (25.74kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LDHAL6A expression in transfected 293T cell line by LDHAL6A polyclonal antibody. Lane 1: LDHAL6A transfected lysate (25.74kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LDHAL6A antibody
Displays an lactate dehydrogenase activity. Significantly increases the transcriptional activity of JUN, when overexpressed.
Product Categories/Family for anti-LDHAL6A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,507 Da
NCBI Official Full Name
L-lactate dehydrogenase A-like 6A
NCBI Official Synonym Full Names
lactate dehydrogenase A-like 6A
NCBI Official Symbol
LDHAL6A
NCBI Official Synonym Symbols
LDH6A
NCBI Protein Information
L-lactate dehydrogenase A-like 6A
UniProt Protein Name
L-lactate dehydrogenase A-like 6A
Protein Family
UniProt Gene Name
LDHAL6A
UniProt Synonym Gene Names
LDHL2
UniProt Entry Name
LDH6A_HUMAN

Uniprot Description

LDHAL6A: Displays an lactate dehydrogenase activity. Significantly increases the transcriptional activity of JUN, when overexpressed. Belongs to the LDH/MDH superfamily. LDH family.

Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; Oxidoreductase; Carbohydrate Metabolism - propanoate; EC 1.1.1.27; Carbohydrate Metabolism - pyruvate; Amino Acid Metabolism - cysteine and methionine

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: cytoplasm

Molecular Function: L-lactate dehydrogenase activity

Biological Process: cellular carbohydrate metabolic process

Research Articles on LDHAL6A

Similar Products

Product Notes

The LDHAL6A ldhal6a (Catalog #AAA6009529) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LDHAL6A (LDHL2, L-lactate Dehydrogenase A-like 6A, MGC23940) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LDHAL6A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the LDHAL6A ldhal6a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MATIKSELIK NFAEEEAIHH NKISIVGTGS VGVACAISIL LKGLSDELVL VDVDEGKLKG ETMDLQHGSP FMKMPNIVSS KDYLVTANSN LVIITAGARQ KKGETRLDLV QRNVSIFKLM IPNITQYSPH CKLLIVTNPV DILTYVAWKL SGFPKNRVIG SGCNLDSARF RYFIGQRLGI HSESCHGLIL GEHGDSSVPV WSGVNIAGVP LKDLNPDIGT DKDPEQWENV HKKK. It is sometimes possible for the material contained within the vial of "LDHAL6A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.