Western Blot (WB)
(WB Suggested Anti-LCN12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Rabbit anti-Human, Mouse LCN12 Polyclonal Antibody | anti-LCN12 antibody
LCN12 antibody - N-terminal region
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LCN12; Polyclonal Antibody; LCN12 antibody - N-terminal region; anti-LCN12 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG
Sequence Length
355
Applicable Applications for anti-LCN12 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LCN12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-LCN12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Western Blot (WB)
(WB Suggested Anti-LCN12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Related Product Information for anti-LCN12 antibody
This is a rabbit polyclonal antibody against LCN12. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.
Target Description: LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.
Product Categories/Family for anti-LCN12 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39kDa
NCBI Official Full Name
epididymal-specific lipocalin-12
NCBI Official Synonym Full Names
lipocalin 12
NCBI Official Symbol
LCN12
NCBI Protein Information
epididymal-specific lipocalin-12
Protein Family
NCBI Description
Members of the lipocalin family, such as LCN12, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx. Lipocalins generally bind small hydrophobic ligands and transport them to specific cells (Suzuki et al., 2004 [PubMed 15363845]).[supplied by OMIM, Aug 2009]
Similar Products
Product Notes
The LCN12 (Catalog #AAA3213917) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LCN12 antibody - N-terminal region reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's LCN12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LCN12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GNQFQGEWFV LGLAGNSFRP EHRALLNAFT ATFELSDDGR FEVWNAMTRG. It is sometimes possible for the material contained within the vial of "LCN12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
