Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of LPHN1 expression in transfected 293T cell line by LPHN1 polyclonal antibody. Lane 1: LPHN1 transfected lysate (20.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Latrophilin 1 Polyclonal Antibody | anti-LPHN1 antibody

Latrophilin 1 (Latrophilin-1, LPHN1, Calcium-independent alpha-latrotoxin Receptor 1, CIRL1, CIRL-1, CL1, KIAA0821, Lectomedin-2, LEC2) APC

Gene Names
LPHN1; CL1; LEC2; CIRL1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Latrophilin 1; Polyclonal Antibody; Latrophilin 1 (Latrophilin-1; LPHN1; Calcium-independent alpha-latrotoxin Receptor 1; CIRL1; CIRL-1; CL1; KIAA0821; Lectomedin-2; LEC2) APC; anti-LPHN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LPHN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-LPHN1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human LPHN1, aa1-201 (AAH19928.1).
Immunogen Sequence
MGLISHLERLMAEGKWGGTGVVEGMGMAEEGAGNGKAVWGMGRGKGERSPSLSSTFPQGRRSQVPGLGSGHPCSGRLDPKSQTPEAPGSGCVLSTCPGPLLSSLSGQPPQPPSLNSRGSIAPGHPSPAPALPFPQRWPLHLCSDLSPSLCPSFSHKCHEFSNIFGSQPAAAMNFVGLRGRGSRKELGGRGQVGGWRDPFCC
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LPHN1 expression in transfected 293T cell line by LPHN1 polyclonal antibody. Lane 1: LPHN1 transfected lysate (20.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LPHN1 expression in transfected 293T cell line by LPHN1 polyclonal antibody. Lane 1: LPHN1 transfected lysate (20.8kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-LPHN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
162,717 Da
NCBI Official Full Name
Homo sapiens latrophilin 1, mRNA
NCBI Official Synonym Full Names
latrophilin 1
NCBI Official Symbol
LPHN1
NCBI Official Synonym Symbols
CL1; LEC2; CIRL1
NCBI Protein Information
latrophilin-1; CIRL-1; lectomedin-2; calcium-independent alpha-latrotoxin receptor 1
UniProt Protein Name
Latrophilin-1
UniProt Gene Name
LPHN1
UniProt Synonym Gene Names
KIAA0821; LEC2; CIRL-1
UniProt Entry Name
LPHN1_HUMAN

NCBI Description

This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Latrophilin-1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane. Alternative splicing results in multiple variants encoding distinct isoforms.[provided by RefSeq, Oct 2008]

Uniprot Description

latrophilin 1: Calcium-independent receptor of high affinity for alpha- latrotoxin, an excitatory neurotoxin present in black widow spider venom which triggers massive exocytosis from neurons and neuroendocrine cells. Receptor propably implicated in the regulation of exocytosis. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; GPCR, family 2; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: presynaptic membrane; neuron projection; growth cone; axon; integral to membrane; plasma membrane; synapse; cell junction

Molecular Function: G-protein coupled receptor activity; protein binding; latrotoxin receptor activity; cell adhesion molecule binding; carbohydrate binding

Biological Process: heterophilic cell adhesion; G-protein coupled receptor protein signaling pathway

Research Articles on LPHN1

Similar Products

Product Notes

The LPHN1 lphn1 (Catalog #AAA6384082) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Latrophilin 1 (Latrophilin-1, LPHN1, Calcium-independent alpha-latrotoxin Receptor 1, CIRL1, CIRL-1, CL1, KIAA0821, Lectomedin-2, LEC2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Latrophilin 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LPHN1 lphn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Latrophilin 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.