Western Blot (WB)
(WB Suggested Anti-LASS4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateCERS4 is supported by BioGPS gene expression data to be expressed in HepG2)
Rabbit LASS4 Polyclonal Antibody | anti-CERS4 antibody
LASS4 antibody - C-terminal region
Gene Names
CERS4; Trh1; LASS4
Reactivity
Tested Reactivity: HumanPredicted Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LASS4; Polyclonal Antibody; LASS4 antibody - C-terminal region; anti-CERS4 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
MLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQEPLQLKNGAAGGPRPAPT
Applicable Applications for anti-CERS4 antibody
Western Blot (WB)
Protein Size (# AA)
394 amino acids
Blocking Peptide
For anti-CERS4 (MBS3202903) antibody is Catalog # MBS3227880.
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human LASS4
Predicted Homology Based on Immunogen Sequence
Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 93%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-LASS4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateCERS4 is supported by BioGPS gene expression data to be expressed in HepG2)
Western Blot (WB)
(WB Suggested Anti-LASS4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateCERS4 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-CERS4 antibody
LASS4 is a member of LASS family. Members of this family regulate (dihydro)ceramide synthases responsible for production of sphingolipids containing different fatty acids.
Product Categories/Family for anti-CERS4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
ceramide synthase 4
NCBI Official Synonym Full Names
ceramide synthase 4
NCBI Official Symbol
CERS4
NCBI Official Synonym Symbols
Trh1; LASS4
NCBI Protein Information
ceramide synthase 4
UniProt Protein Name
Ceramide synthase 4
Protein Family
UniProt Gene Name
CERS4
UniProt Synonym Gene Names
LASS4; CerS4
UniProt Entry Name
CERS4_HUMAN
Uniprot Description
Lass4: May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing different fatty acid donors (N-linked stearoyl- (C18) or arachidoyl- (C20) ceramides) in a fumonisin B1-independent manner.
Protein type: Membrane protein, multi-pass; DNA-binding; Membrane protein, integral
Chromosomal Location of Human Ortholog: 19p13.2
Cellular Component: endoplasmic reticulum membrane; nuclear membrane; endoplasmic reticulum; integral to membrane
Molecular Function: DNA binding; sphingosine N-acyltransferase activity
Biological Process: sphingolipid metabolic process; sphingolipid biosynthetic process; ceramide biosynthetic process
Research Articles on CERS4
Similar Products
Product Notes
The CERS4 cers4 (Catalog #AAA3202903) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LASS4 antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's LASS4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CERS4 cers4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLYSFMKKGQ MEKDIRSDVE ESDSSEEAAA AQEPLQLKNG AAGGPRPAPT. It is sometimes possible for the material contained within the vial of "LASS4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
