Western Blot (WB)
(WB Suggested Anti-LAMP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
Rabbit anti-Human LAMP3 Polyclonal Antibody | anti-LAMP3 antibody
LAMP3 antibody - N-terminal region
Gene Names
LAMP3; LAMP; CD208; DCLAMP; LAMP-3; TSC403; DC LAMP; DC-LAMP
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LAMP3; Polyclonal Antibody; LAMP3 antibody - N-terminal region; anti-LAMP3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT
Sequence Length
416
Applicable Applications for anti-LAMP3 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LAMP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-LAMP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
Western Blot (WB)
(WB Suggested Anti-LAMP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
Related Product Information for anti-LAMP3 antibody
This is a rabbit polyclonal antibody against LAMP3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: LAMP3 might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells. LAMP3 overexpression is associated with an enhanced metastatic potential and may be a prognostic factor for cervical cancer.
Target Description: LAMP3 might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells. LAMP3 overexpression is associated with an enhanced metastatic potential and may be a prognostic factor for cervical cancer.
Product Categories/Family for anti-LAMP3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
lysosome-associated membrane glycoprotein 3
NCBI Official Synonym Full Names
lysosomal associated membrane protein 3
NCBI Official Symbol
LAMP3
NCBI Official Synonym Symbols
LAMP; CD208; DCLAMP; LAMP-3; TSC403; DC LAMP; DC-LAMP
NCBI Protein Information
lysosome-associated membrane glycoprotein 3
UniProt Protein Name
Lysosome-associated membrane glycoprotein 3
Protein Family
UniProt Gene Name
LAMP3
UniProt Synonym Gene Names
DCLAMP; TSC403; LAMP-3; Lysosomal-associated membrane protein 3; DC LAMP
UniProt Entry Name
LAMP3_HUMAN
NCBI Description
Dendritic cells (DCs) are the most potent antigen-presenting cells. Immature DCs efficiently capture antigens and differentiate into interdigitating dendritic cells (IDCs) in lymphoid tissues that induce primary T-cell responses (summary by de Saint-Vis et al., 1998 [PubMed 9768752]).[supplied by OMIM, Dec 2010]
Uniprot Description
LAMP3: Might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells. Belongs to the LAMP family.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 3q26.3-q27
Cellular Component: lysosomal membrane; integral to membrane
Biological Process: cell proliferation; immune system process
Research Articles on LAMP3
Similar Products
Product Notes
The LAMP3 lamp3 (Catalog #AAA3205937) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LAMP3 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LAMP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LAMP3 lamp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YSQPTAAATV QDIKKPVQQP AKQAPHQTLA ARFMDGHITF QTAATVKIPT. It is sometimes possible for the material contained within the vial of "LAMP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
