Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using LAD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Rabbit LAD1 Polyclonal Antibody | anti-LAD1 antibody
LAD1 Rabbit pAb
Gene Names
LAD1; LadA
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
LAD1; Polyclonal Antibody; LAD1 Rabbit pAb; LadA; anti-LAD1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
TTDDEAPRLSQNGDRQASASERLPSVEEAEVPKPLPPASKDEDEDIQSILRTRQERRQRRQVVEAAQAPIQERLEAEEGRNSLSPVQATQKPLVSKKELEIPPRRRLSREQRGPWALEEESLVGREPEERKKGVPEKSPVLEKSSMPKKTAPEKSLVSDKT
Applicable Applications for anti-LAD1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:100-1:200
IHC: 1:100-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 40-200 of human LAD1 (NP_005549.2).
Positive Samples
HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using LAD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using LAD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Related Product Information for anti-LAD1 antibody
Background: The protein encoded by this gene may be an anchoring filament that is a component of basement membranes. It may contribute to the stability of the association of the epithelial layers with the underlying mesenchyme. [provided by RefSeq, Jul 2008]
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
57,131 Da
NCBI Official Full Name
ladinin-1
NCBI Official Synonym Full Names
ladinin 1
NCBI Official Symbol
LAD1
NCBI Official Synonym Symbols
LadA
NCBI Protein Information
ladinin-1; lad-1; linear IgA bullous dermatosis antigen; linear IgA disease antigen homolog
UniProt Protein Name
Ladinin-1
Protein Family
UniProt Gene Name
LAD1
UniProt Synonym Gene Names
LAD; Lad-1; LADA
UniProt Entry Name
LAD1_HUMAN
Similar Products
Product Notes
The LAD1 lad1 (Catalog #AAA9142803) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LAD1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LAD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:100-1:200. Researchers should empirically determine the suitability of the LAD1 lad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TTDDEAPRLS QNGDRQASAS ERLPSVEEAE VPKPLPPASK DEDEDIQSIL RTRQERRQRR QVVEAAQAPI QERLEAEEGR NSLSPVQATQ KPLVSKKELE IPPRRRLSRE QRGPWALEEE SLVGREPEER KKGVPEKSPV LEKSSMPKKT APEKSLVSDK T. It is sometimes possible for the material contained within the vial of "LAD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
