Western Blot (WB)
(WB Suggested Anti-LACTB Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)
Rabbit LACTB Polyclonal Antibody | anti-LACTB antibody
LACTB antibody - C-terminal region
Gene Names
LACTB; G24; MRPL56
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LACTB; Polyclonal Antibody; LACTB antibody - C-terminal region; anti-LACTB antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL
Sequence Length
547
Applicable Applications for anti-LACTB antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human LACTB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-LACTB Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)
Western Blot (WB)
(WB Suggested Anti-LACTB Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)
Related Product Information for anti-LACTB antibody
This is a rabbit polyclonal antibody against LACTB. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.This gene encodes a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). The encoded protein has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.
Target Description: LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.This gene encodes a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). The encoded protein has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.
Product Categories/Family for anti-LACTB antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
serine beta-lactamase-like protein LACTB, mitochondrial isoform a
NCBI Official Synonym Full Names
lactamase beta
NCBI Official Symbol
LACTB
NCBI Official Synonym Symbols
G24; MRPL56
NCBI Protein Information
serine beta-lactamase-like protein LACTB, mitochondrial
UniProt Protein Name
Serine beta-lactamase-like protein LACTB, mitochondrial
Protein Family
UniProt Gene Name
LACTB
UniProt Synonym Gene Names
MRPL56
UniProt Entry Name
LACTB_HUMAN
NCBI Description
This gene encodes a mitochondrially-localized protein that has sequence similarity to prokaryotic beta-lactamases. Many of the residues responsible for beta-lactamase activity are not conserved in this protein, suggesting it may have a different enzymatic function. Increased expression of the related mouse gene was found to be associated with obesity. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Dec 2013]
Research Articles on LACTB
Similar Products
Product Notes
The LACTB lactb (Catalog #AAA3210790) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LACTB antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LACTB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LACTB lactb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TEMSWDKEGK YAMAWGVVER KQTYGSCRKQ RHYASHTGGA VGASSVLLVL. It is sometimes possible for the material contained within the vial of "LACTB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
