Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (LDHA rabbit polyclonal antibody. Western Blot analysis of LDHA expression in human kidney.)

Rabbit anti-Human Lactate Dehydrogenase Polyclonal Antibody | anti-LD antibody

Lactate Dehydrogenase (LD, LDHA, LDHB, LDH Heart Subunit, LDHH, LDH1, LDH Muscle Subunit, LDHM, NY-REN-46 Antigen, NY-REN-59 Antigen, Proliferation Inducing Gene 19 Protein, PIG19, TRG5) (HRP)

Gene Names
LDHA; LDH1; LDHM; GSD11; PIG19; HEL-S-133P
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Lactate Dehydrogenase; Polyclonal Antibody; Lactate Dehydrogenase (LD; LDHA; LDHB; LDH Heart Subunit; LDHH; LDH1; LDH Muscle Subunit; LDHM; NY-REN-46 Antigen; NY-REN-59 Antigen; Proliferation Inducing Gene 19 Protein; PIG19; TRG5) (HRP); anti-LD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LDHA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-LD antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human LDHA, aa1-332 (NP_005557.1).
Immunogen Sequence
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(LDHA rabbit polyclonal antibody. Western Blot analysis of LDHA expression in human kidney.)

Western Blot (WB) (LDHA rabbit polyclonal antibody. Western Blot analysis of LDHA expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of LDHA expression in transfected 293T cell line by LDHA polyclonal antibody. Lane 1: LDHA transfected lysate (36.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LDHA expression in transfected 293T cell line by LDHA polyclonal antibody. Lane 1: LDHA transfected lysate (36.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LD antibody
Lactate dehydrogenase (LDH) contains two isoforms in mammals, LDH-M and LDH-H, which come together to form a homotetramer of 36kD subunits. LDH is often as a marker for tissue breakdown or cytotoxicity. LDH shows cytoplasm localization.
Product Categories/Family for anti-LD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,712 Da
NCBI Official Full Name
L-lactate dehydrogenase A chain isoform 1
NCBI Official Synonym Full Names
lactate dehydrogenase A
NCBI Official Symbol
LDHA
NCBI Official Synonym Symbols
LDH1; LDHM; GSD11; PIG19; HEL-S-133P
NCBI Protein Information
L-lactate dehydrogenase A chain; LDH-A; LDH-M; LDH muscle subunit; lactate dehydrogenase M; proliferation-inducing gene 19; renal carcinoma antigen NY-REN-59; cell proliferation-inducing gene 19 protein; epididymis secretory sperm binding protein Li 133P
UniProt Protein Name
L-lactate dehydrogenase A chain
Protein Family
UniProt Gene Name
LDHA
UniProt Synonym Gene Names
LDH-A; LDH-M
UniProt Entry Name
LDHA_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene. [provided by RefSeq, Sep 2008]

Research Articles on LD

Similar Products

Product Notes

The LD ldha (Catalog #AAA6384008) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Lactate Dehydrogenase (LD, LDHA, LDHB, LDH Heart Subunit, LDHH, LDH1, LDH Muscle Subunit, LDHM, NY-REN-46 Antigen, NY-REN-59 Antigen, Proliferation Inducing Gene 19 Protein, PIG19, TRG5) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Lactate Dehydrogenase can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LD ldha for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Lactate Dehydrogenase, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.