Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RP11-82K18.3 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysateCCBL2 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit KYAT3 Polyclonal Antibody | anti-KYAT3 antibody

KYAT3 Antibody - N-terminal region

Gene Names
KYAT3; KAT3; CCBL2; KATIII
Reactivity
Reacts with: Human
Predicted reacts with: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
KYAT3; Polyclonal Antibody; KYAT3 Antibody - N-terminal region; anti-KYAT3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Reacts with: Human
Predicted reacts with: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAA
Sequence Length
420
Applicable Applications for anti-KYAT3 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 93%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 91%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-82K18.3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RP11-82K18.3 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysateCCBL2 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-RP11-82K18.3 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysateCCBL2 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-KYAT3 antibody
This is a rabbit polyclonal antibody against RP11-82K18.3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid, which is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the RNA binding motif protein, X-linked-like 1 locus on chromosome 1, but the coding sequences are non-overlapping.
Product Categories/Family for anti-KYAT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
kynurenine--oxoglutarate transaminase 3 isoform 2
NCBI Official Synonym Full Names
kynurenine aminotransferase 3
NCBI Official Symbol
KYAT3
NCBI Official Synonym Symbols
KAT3; CCBL2; KATIII
NCBI Protein Information
kynurenine--oxoglutarate transaminase 3
UniProt Protein Name
Kynurenine--oxoglutarate transaminase 3
UniProt Gene Name
CCBL2
UniProt Synonym Gene Names
KAT3; KATIII
UniProt Entry Name
KAT3_HUMAN

NCBI Description

This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid, which is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the RNA binding motif protein, X-linked-like 1 locus on chromosome 1, but the coding sequences are non-overlapping. [provided by RefSeq, Mar 2017]

Uniprot Description

CCBL2: Catalyzes the irreversible transamination of the L- tryptophan metabolite L-kynurenine to form kynurenic acid (KA). May catalyze the beta-elimination of S-conjugates and Se- conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond. Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro). Has lower activity with 2- oxoglutarate as amino group acceptor (in vitro). Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Lyase; EC 2.6.1.63; EC 2.6.1.7; Transferase; EC 4.4.1.13

Chromosomal Location of Human Ortholog: 1p22.2

Cellular Component: mitochondrion

Molecular Function: cysteine-S-conjugate beta-lyase activity; protein homodimerization activity; kynurenine-oxoglutarate transaminase activity; kynurenine-glyoxylate transaminase activity; pyridoxal phosphate binding

Biological Process: amino acid metabolic process; biosynthetic process; tryptophan catabolic process; 2-oxoglutarate metabolic process

Research Articles on KYAT3

Similar Products

Product Notes

The KYAT3 ccbl2 (Catalog #AAA3205107) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KYAT3 Antibody - N-terminal region reacts with Reacts with: Human Predicted reacts with: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KYAT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KYAT3 ccbl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGRAKFLKTI SSSKILGFST SAKMSLKFTN AKRIEGLDSN VWIEFTKLAA. It is sometimes possible for the material contained within the vial of "KYAT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.