Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KRT12Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human KRT12 Polyclonal Antibody | anti-KRT12 antibody

KRT12 Antibody - N-terminal region

Gene Names
KRT12; K12
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KRT12; Polyclonal Antibody; KRT12 Antibody - N-terminal region; anti-KRT12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYYPLIEDLRNK
Sequence Length
494
Applicable Applications for anti-KRT12 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human KRT12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KRT12Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KRT12Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-KRT12 antibody
This is a rabbit polyclonal antibody against KRT12. It was validated on Western Blot

Target Description: KRT12 encodes the type I intermediate filament chain keratin 12, expressed in corneal epithelia. Mutations in this gene lead to Meesmann corneal dystrophy.
Product Categories/Family for anti-KRT12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
keratin, type I cytoskeletal 12
NCBI Official Synonym Full Names
keratin 12
NCBI Official Symbol
KRT12
NCBI Official Synonym Symbols
K12
NCBI Protein Information
keratin, type I cytoskeletal 12
UniProt Protein Name
Keratin, type I cytoskeletal 12
Protein Family
UniProt Gene Name
KRT12
UniProt Synonym Gene Names
CK-12; K12
UniProt Entry Name
K1C12_HUMAN

NCBI Description

KRT12 encodes the type I intermediate filament chain keratin 12, expressed in corneal epithelia. Mutations in this gene lead to Meesmann corneal dystrophy. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May play a unique role in maintaining the normal corneal epithelial function. Together with KRT3, essential for the maintenance of corneal epithelium integrity

By similarity.

Subunit structure: Heterotetramer of two type I and two type II keratins. Keratin-3 associates with keratin-12.

Tissue specificity: Cornea specific. Ref.1

Involvement in disease: Corneal dystrophy, Meesmann (MECD) [MIM:122100]: An autosomal dominant corneal disease characterized by fragility of the anterior corneal epithelium. Patients are usually asymptomatic until adulthood when rupture of the corneal microcysts may cause erosions, producing clinical symptoms such as photophobia, contact lens intolerance and intermittent diminution of visual acuity. Rarely, subepithelial scarring causes irregular corneal astigmatism and permanent visual impairment. Histological examination shows a disorganized and thickened epithelium with widespread cytoplasmic vacuolation and numerous small, round, debris-laden intraepithelial cysts.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.2 Ref.3 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13

Miscellaneous: There are two types of cytoskeletal and microfibrillar keratin: I (acidic; 40-55 kDa) and II (neutral to basic; 56-70 kDa).

Sequence similarities: Belongs to the intermediate filament family.

Research Articles on KRT12

Similar Products

Product Notes

The KRT12 krt12 (Catalog #AAA3216392) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KRT12 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KRT12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KRT12 krt12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LDKVRALEEA NTELENKIRE WYETRGTGTA DASQSDYSKY YPLIEDLRNK. It is sometimes possible for the material contained within the vial of "KRT12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.