Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of KRIT1 expression in rat cardiac muscle extract (lane 1), NIH3T3 whole cell lysates (lane 2) and HELA whole cell lysates (lane 3). KRIT1 at 84KD was detected using rabbit anti-KRIT1 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit KRIT1 Polyclonal Antibody | anti-KRIT1 antibody

Anti-KRIT1 Antibody

Gene Names
KRIT1; CAM; CCM1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
KRIT1; Polyclonal Antibody; Anti-KRIT1 Antibody; CAM; CCM 1; CCM1; KRIT 1; O00522; Krev interaction trapped protein 1; ankyrin repeat containing; anti-KRIT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
688
Applicable Applications for anti-KRIT1 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human KRIT1 (703-736aa ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS), different from the related mouse sequence by one amino acid.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of KRIT1 expression in rat cardiac muscle extract (lane 1), NIH3T3 whole cell lysates (lane 2) and HELA whole cell lysates (lane 3). KRIT1 at 84KD was detected using rabbit anti-KRIT1 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of KRIT1 expression in rat cardiac muscle extract (lane 1), NIH3T3 whole cell lysates (lane 2) and HELA whole cell lysates (lane 3). KRIT1 at 84KD was detected using rabbit anti-KRIT1 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-KRIT1 antibody
Rabbit IgG polyclonal antibody for Krev interaction trapped protein 1(KRIT1) detection.
Background: Krev interaction trapped protein 1(KRIT1) is a protein that in humans is encoded by the CCM1 gene. This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene.
References
1. Eerola I, McIntyre B, Vikkula M (Feb 2001). "Identification of eight novel 5'-exons in cerebral capillary malformation gene-1 (CCM1) encoding KRIT1".Biochimica et Biophysica Acta 1517 (3): 464-7.
2. Pagenstecher A, Stahl S, Sure U, Felbor U (Mar 2009)."A two-hit mechanism causes cerebral cavernous malformations: complete inactivation of CCM1, CCM2 or CCM3 in affected endothelial cells". Human Molecular Genetics 18 (5): 911-8.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
889
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78,650 Da
NCBI Official Full Name
krev interaction trapped protein 1 isoform 2
NCBI Official Synonym Full Names
KRIT1, ankyrin repeat containing
NCBI Official Symbol
KRIT1
NCBI Official Synonym Symbols
CAM; CCM1
NCBI Protein Information
krev interaction trapped protein 1
UniProt Protein Name
Krev interaction trapped protein 1
UniProt Gene Name
KRIT1
UniProt Synonym Gene Names
CCM1; Krev interaction trapped 1

NCBI Description

This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2009]

Uniprot Description

KRIT1: Component of the CCM signaling pathway which is a crucial regulator of heart and vessel formation and integrity. Negative regulator of angiogenesis. Inhibits endothelial proliferation, apoptosis, migration, lumen formation and sprouting angiogenesis in primary endothelial cells. Promotes AKT phosphorylation in a NOTCH-dependent and independent manner, and inhibits EKR1/2 phosphorylation indirectly through activation of the DELTA-NOTCH cascade. Acts in concert with CDH5 to establish and maintain correct endothelial cell polarity and vascular lumen and these effects are mediated by recruitment and activation of the Par polarity complex and RAP1B. Required for the localization of phosphorylated PRKCZ, PARD3, TIAM1 and RAP1B to the cell junction, and cell junction stabilization. Plays an important role in the maintenance of the intracellular reactive oxygen species (ROS) homeostasis to prevent oxidative cellular damage. Regulates the homeostasis of intracellular ROS through an antioxidant pathway involving FOXO1 and SOD2. Facilitates the down-regulation of cyclin-D1 (CCND1) levels required for cell transition from proliferative growth to quiescence by preventing the accumulation of intracellular ROS through the modulation of FOXO1 and SOD2 levels. Defects in KRIT1 are the cause of cerebral cavernous malformations type 1 (CCM1). Cerebral cavernous malformations (CCMs) are congenital vascular anomalies of the central nervous system that can result in hemorrhagic stroke, seizures, recurrent headaches, and focal neurologic deficits. CCMs have an incidence of 0.1%-0.5% in the general population and usually present clinically during the 3rd to 5th decade of life. The lesions are characterized by grossly enlarged blood vessels consisting of a single layer of endothelium and without any intervening neural tissue, ranging in diameter from a few millimeters to several centimeters. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein regulator, misc.; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 7q21.2

Cellular Component: extracellular space; intercellular junction; microtubule; plasma membrane

Molecular Function: GTPase regulator activity; microtubule binding; phosphatidylinositol-4,5-bisphosphate binding; protein binding; protein complex binding

Biological Process: cell redox homeostasis; negative regulation of angiogenesis; negative regulation of endothelial cell proliferation; small GTPase mediated signal transduction

Disease: Cerebral Cavernous Malformations

Research Articles on KRIT1

Similar Products

Product Notes

The KRIT1 krit1 (Catalog #AAA178830) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-KRIT1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KRIT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the KRIT1 krit1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KRIT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.