Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IMA6 antibody Titration: 1 ug/mLSample Type: Human 293T Whole Cell)

Rabbit anti-Human KPNA5 Polyclonal Antibody | anti-KPNA5 antibody

KPNA5 Antibody - N-terminal region

Gene Names
KPNA5; SRP6; IPOA6
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KPNA5; Polyclonal Antibody; KPNA5 Antibody - N-terminal region; anti-KPNA5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESP
Sequence Length
536
Applicable Applications for anti-KPNA5 antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-KPNA5 antibody is: synthetic peptide directed towards the N-terminal region of Human IMA6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IMA6 antibody Titration: 1 ug/mLSample Type: Human 293T Whole Cell)

Western Blot (WB) (WB Suggested Anti-IMA6 antibody Titration: 1 ug/mLSample Type: Human 293T Whole Cell)
Related Product Information for anti-KPNA5 antibody
This is a rabbit polyclonal antibody against IMA6. It was validated on Western Blot

Target Description: The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus.
Product Categories/Family for anti-KPNA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
Importin subunit alpha-6
NCBI Official Synonym Full Names
karyopherin subunit alpha 5
NCBI Official Symbol
KPNA5
NCBI Official Synonym Symbols
SRP6; IPOA6
NCBI Protein Information
importin subunit alpha-6
UniProt Protein Name
Importin subunit alpha-6
UniProt Gene Name
KPNA5
UniProt Entry Name
IMA6_HUMAN

NCBI Description

The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus. [provided by RefSeq, Jul 2008]

Uniprot Description

KPNA5: Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran- dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates nuclear import of STAT1 homodimers and STAT1/STAT2 heterodimers by recognizing non- classical NLSs of STAT1 and STAT2 through ARM repeats 8-9. Recognizes influenza A virus nucleoprotein through ARM repeat 7-9 In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS. Belongs to the importin alpha family.

Protein type: Nuclear import; Karyopherin

Chromosomal Location of Human Ortholog: 6q22.1

Cellular Component: nucleoplasm; cytoplasm; cytosol

Molecular Function: protein binding; protein transporter activity

Biological Process: cytokine and chemokine mediated signaling pathway; NLS-bearing substrate import into nucleus

Research Articles on KPNA5

Similar Products

Product Notes

The KPNA5 kpna5 (Catalog #AAA3220317) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KPNA5 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KPNA5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KPNA5 kpna5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YKNKALNPQE MRRRREEEGI QLRKQKREEQ LFKRRNVYLP RNDESMLESP. It is sometimes possible for the material contained within the vial of "KPNA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.